Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 54 showing 1061 ~ 1080 out of 1,256 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

http://antibodyregistry.org/AB_3697090

Comments: Applications: IP, CoIP
Host Organism: Alpaca
Clonality: recombinant
Target(s): IgG

Proper citation: Proteintech Cat# rIGa, RRID:AB_3697090 Copy   


http://antibodyregistry.org/AB_3666493

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Tenuazonic acid VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54243, RRID:AB_3666493 Copy   


http://antibodyregistry.org/AB_3666919

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): RECQL5 VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54671, RRID:AB_3666919 Copy   


  • RRID:AB_3674450

http://antibodyregistry.org/AB_3674450

Comments: Applications: IP, Co-IP
Host Organism: Alpaca
Clonality: unknown
Target(s): Strep-Tag® (sequence: SAWSHPQFEK) and Twin-Strep-Tag® (sequence: SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK)

Proper citation: ChromoTek Cat# qtak, RRID:AB_3674450 Copy   


http://antibodyregistry.org/AB_3666843

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Histone H2A.X VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54593, RRID:AB_3666843 Copy   


http://antibodyregistry.org/AB_3666971

Comments: Applications: ELISA, SPR
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): WFDC2 VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54723, RRID:AB_3666971 Copy   


http://antibodyregistry.org/AB_3666577

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Aztreonam VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54327, RRID:AB_3666577 Copy   


http://antibodyregistry.org/AB_3666872

Comments: Applications: Flow, IP, WB
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): LSP1 VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54624, RRID:AB_3666872 Copy   


http://antibodyregistry.org/AB_3667056

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Lysozyme VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54808, RRID:AB_3667056 Copy   


http://antibodyregistry.org/AB_3666693

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): ADAM17 VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54443, RRID:AB_3666693 Copy   


http://antibodyregistry.org/AB_3666520

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Ricin alpha VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54270, RRID:AB_3666520 Copy   


http://antibodyregistry.org/AB_3666506

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Ricin alpha VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54256, RRID:AB_3666506 Copy   


http://antibodyregistry.org/AB_3666860

Comments: Applications: ELISA, SPR
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): IL23A VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54612, RRID:AB_3666860 Copy   


http://antibodyregistry.org/AB_3666923

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): RECQL5 VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54675, RRID:AB_3666923 Copy   


http://antibodyregistry.org/AB_3666631

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Apelin Receptor VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54381, RRID:AB_3666631 Copy   


http://antibodyregistry.org/AB_3666771

Comments: Applications: ELISA, Flow
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): CFTR VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54521, RRID:AB_3666771 Copy   


http://antibodyregistry.org/AB_3666786

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Carboxypeptidase B2 VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54536, RRID:AB_3666786 Copy   


  • RRID:AB_3674464

http://antibodyregistry.org/AB_3674464

Comments: Applications: IP, CoIP
Host Organism: Alpaca
Clonality: unknown
Target(s): PARP1

Proper citation: ChromoTek Cat# xtak, RRID:AB_3674464 Copy   


http://antibodyregistry.org/AB_3668670

Comments: Applications: IF
Host Organism: Alpaca
Clonality: monoclonal
Target(s): ALFA-tag

Proper citation: NanoTag Biotechnologies Cat# N1502-JF635B-L, RRID:AB_3668670 Copy   


http://antibodyregistry.org/AB_3666591

Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): HIV1 Gag VHH-8His-Cys-tag

Proper citation: Thermo Fisher Scientific Cat# MA5-54341, RRID:AB_3666591 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X