Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_3697090
Comments: Applications: IP, CoIP
Host Organism: Alpaca
Clonality: recombinant
Target(s): IgG
Proper citation: Proteintech Cat# rIGa, RRID:AB_3697090 Copy
http://antibodyregistry.org/AB_3666493
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Tenuazonic acid VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54243, RRID:AB_3666493 Copy
http://antibodyregistry.org/AB_3666919
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): RECQL5 VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54671, RRID:AB_3666919 Copy
http://antibodyregistry.org/AB_3674450
Comments: Applications: IP, Co-IP
Host Organism: Alpaca
Clonality: unknown
Target(s): Strep-Tag® (sequence: SAWSHPQFEK) and Twin-Strep-Tag® (sequence: SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK)
Proper citation: ChromoTek Cat# qtak, RRID:AB_3674450 Copy
http://antibodyregistry.org/AB_3666843
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Histone H2A.X VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54593, RRID:AB_3666843 Copy
http://antibodyregistry.org/AB_3666971
Comments: Applications: ELISA, SPR
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): WFDC2 VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54723, RRID:AB_3666971 Copy
http://antibodyregistry.org/AB_3666577
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Aztreonam VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54327, RRID:AB_3666577 Copy
http://antibodyregistry.org/AB_3666872
Comments: Applications: Flow, IP, WB
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): LSP1 VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54624, RRID:AB_3666872 Copy
http://antibodyregistry.org/AB_3667056
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Lysozyme VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54808, RRID:AB_3667056 Copy
http://antibodyregistry.org/AB_3666693
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): ADAM17 VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54443, RRID:AB_3666693 Copy
http://antibodyregistry.org/AB_3666520
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Ricin alpha VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54270, RRID:AB_3666520 Copy
http://antibodyregistry.org/AB_3666506
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Ricin alpha VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54256, RRID:AB_3666506 Copy
http://antibodyregistry.org/AB_3666860
Comments: Applications: ELISA, SPR
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): IL23A VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54612, RRID:AB_3666860 Copy
http://antibodyregistry.org/AB_3666923
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): RECQL5 VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54675, RRID:AB_3666923 Copy
http://antibodyregistry.org/AB_3666631
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Apelin Receptor VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54381, RRID:AB_3666631 Copy
http://antibodyregistry.org/AB_3666771
Comments: Applications: ELISA, Flow
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): CFTR VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54521, RRID:AB_3666771 Copy
http://antibodyregistry.org/AB_3666786
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): Carboxypeptidase B2 VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54536, RRID:AB_3666786 Copy
http://antibodyregistry.org/AB_3674464
Comments: Applications: IP, CoIP
Host Organism: Alpaca
Clonality: unknown
Target(s): PARP1
Proper citation: ChromoTek Cat# xtak, RRID:AB_3674464 Copy
http://antibodyregistry.org/AB_3668670
Comments: Applications: IF
Host Organism: Alpaca
Clonality: monoclonal
Target(s): ALFA-tag
Proper citation: NanoTag Biotechnologies Cat# N1502-JF635B-L, RRID:AB_3668670 Copy
http://antibodyregistry.org/AB_3666591
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality: recombinant monoclonal
Target(s): HIV1 Gag VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54341, RRID:AB_3666591 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.