Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669638
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NALCN
Proper citation: Atlas Antibodies Cat# HPA031889, RRID:AB_10669638 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673901
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MTUS2
Proper citation: Atlas Antibodies Cat# HPA031473, RRID:AB_2673901 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674099
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ABCC11
Proper citation: Atlas Antibodies Cat# HPA031982, RRID:AB_2674099 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10610279
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PHACTR2
Proper citation: Atlas Antibodies Cat# HPA031725, RRID:AB_10610279 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602234
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HIC2
Proper citation: Atlas Antibodies Cat# HPA031884, RRID:AB_10602234 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673966
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MOV10
Proper citation: Atlas Antibodies Cat# HPA031627, RRID:AB_2673966 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10610419
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RPS25
Proper citation: Atlas Antibodies Cat# HPA031801, RRID:AB_10610419 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673992
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SFRQPFTPTSRSLLRQPDISCILGTGGKSPRLTQSSGFFGNLSMVTNLDDSNWAAAFSSQRSGLFTNTEPHSITEDVTISAVMLREDDPGEAASMSMFSDFLQSFLKHSSSTVFDLVEEYENICGSQVNIL; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): NUP107
Proper citation: Atlas Antibodies Cat# HPA031679, RRID:AB_2673992 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601018
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPR107
Proper citation: Atlas Antibodies Cat# HPA031704, RRID:AB_10601018 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602095
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAGI1
Proper citation: Atlas Antibodies Cat# HPA031853, RRID:AB_10602095 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674056
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ING4
Proper citation: Atlas Antibodies Cat# HPA031817, RRID:AB_2674056 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674135
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRNAU1AP
Proper citation: Atlas Antibodies Cat# HPA032068, RRID:AB_2674135 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674074
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAGI1
Proper citation: Atlas Antibodies Cat# HPA031852, RRID:AB_2674074 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602198
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MIPEP
Proper citation: Atlas Antibodies Cat# HPA031670, RRID:AB_10602198 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673995
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): KYNU
Proper citation: Atlas Antibodies Cat# HPA031686, RRID:AB_2673995 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674080
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC38A3
Proper citation: Atlas Antibodies Cat# HPA031871, RRID:AB_2674080 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674037
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZBTB8A
Proper citation: Atlas Antibodies Cat# HPA031770, RRID:AB_2674037 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601693
Comments: Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): MB21D1
Proper citation: Atlas Antibodies Cat# HPA031700, RRID:AB_10601693 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603326
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UST
Proper citation: Atlas Antibodies Cat# HPA032022, RRID:AB_10603326 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669915
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): REC8
Proper citation: Atlas Antibodies Cat# HPA031729, RRID:AB_10669915 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.