Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 437 showing 8721 ~ 8740 out of 1,440,284 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

    • RRID:AB_1852483

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1852483

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIF21B

Proper citation: Atlas Antibodies Cat# HPA027274, RRID:AB_1852483 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1858316

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRIM66

Proper citation: Atlas Antibodies Cat# HPA027420, RRID:AB_1858316 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2672174

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): S100PBP

Proper citation: Atlas Antibodies Cat# HPA027242, RRID:AB_2672174 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10600223

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): STK36

Proper citation: Atlas Antibodies Cat# HPA027409, RRID:AB_10600223 Copy   

    • RRID:AB_1852717

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1852717

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CERS2

Proper citation: Atlas Antibodies Cat# HPA027262, RRID:AB_1852717 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602680

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): VEZF1

Proper citation: Atlas Antibodies Cat# HPA027520, RRID:AB_10602680 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10603774

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPIDR

Proper citation: Atlas Antibodies Cat# HPA027201, RRID:AB_10603774 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601150

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C8orf4

Proper citation: Atlas Antibodies Cat# HPA027188, RRID:AB_10601150 Copy   

    • RRID:AB_10603124

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10603124

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NUS1

Proper citation: Atlas Antibodies Cat# HPA027504, RRID:AB_10603124 Copy   

    • RRID:AB_10602317

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602317

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ALKAL1

Proper citation: Atlas Antibodies Cat# HPA027368, RRID:AB_10602317 Copy   

    • RRID:AB_2672215

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2672215

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TP73

Proper citation: Atlas Antibodies Cat# HPA027314, RRID:AB_2672215 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601097

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): CD300LD

Proper citation: Atlas Antibodies Cat# HPA027756, RRID:AB_10601097 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601210

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DNAH14

Proper citation: Atlas Antibodies Cat# HPA027718, RRID:AB_10601210 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601898

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): USH1C

Proper citation: Atlas Antibodies Cat# HPA027492, RRID:AB_10601898 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10609994

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IRF2BP2

Proper citation: Atlas Antibodies Cat# HPA027815, RRID:AB_10609994 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2672390

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCND1

Proper citation: Atlas Antibodies Cat# HPA027802, RRID:AB_2672390 Copy   

    • RRID:AB_10601482

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601482

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RNF220

Proper citation: Atlas Antibodies Cat# HPA027578, RRID:AB_10601482 Copy   

    • RRID:AB_1847976

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847976

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ECM1

Proper citation: Atlas Antibodies Cat# HPA027241, RRID:AB_1847976 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10603001

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): USP43

Proper citation: Atlas Antibodies Cat# HPA027762, RRID:AB_10603001 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855107

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PDCD4

Proper citation: Atlas Antibodies Cat# HPA027214, RRID:AB_1855107 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

NIH Data Sharing and Reuse Seminar- Sex Differences in Acute Kidney Injury Risk and Outcomes: Insights from MIMIC-III and MIMIC-IV

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch