Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Clonality:polyclonal (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

1,440,284 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Target Antigen

Sort Ascending

Sort Descending

 Target Organism

Sort Ascending

Sort Descending

 Clone ID
Defining Citation

Sort Ascending

Sort Descending

 Comments
Clonality

Sort Ascending

Sort Descending

 Host Organism

Sort Ascending

Sort Descending

 Antibody ID
Vendor

Sort Ascending

Sort Descending

 Catalog Number
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
Anti-BCL11A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA029003, RRID:AB_2672863 BCL11A human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672863 Atlas Antibodies HPA029003 2026-08-29 04:09:05 0
Anti-SPHK1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028761, RRID:AB_10600814 SPHK1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTAS; Manufacturer approved use: IHC polyclonal rabbit AB_10600814 Atlas Antibodies HPA028761 2026-08-28 07:20:10 0
Anti-FLAD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028563, RRID:AB_10602286 FLAD1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602286 Atlas Antibodies HPA028563 2026-08-31 12:18:20 0
Anti-CCDC190 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028592, RRID:AB_10601001 CCDC190 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601001 Atlas Antibodies HPA028592 2026-08-29 03:03:42 0
Anti-ADAMTS9 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028567, RRID:AB_10599275 ADAMTS9 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10599275 Atlas Antibodies HPA028567 2026-08-31 12:09:29 0
Anti-ACOX1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028759, RRID:AB_10601352 ACOX1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601352 Atlas Antibodies HPA028759 2026-08-29 03:40:23 0
Anti-UBE2K polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028869, RRID:AB_10602487 UBE2K human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602487 Atlas Antibodies HPA028869 2026-08-29 04:06:21 0
Anti-DNAH14 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028545, RRID:AB_2672665 DNAH14 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672665 Atlas Antibodies HPA028545 2026-08-31 09:54:24 0
Anti-IFI27 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028875, RRID:AB_10601434 IFI27 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601434 Atlas Antibodies HPA028875 2026-08-29 06:50:01 0
Anti-CCDC190 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028584, RRID:AB_10599423 CCDC190 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10599423 Atlas Antibodies HPA028584 2026-08-31 09:07:45 0
Anti-PLPP3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028892, RRID:AB_10602149 PLPP3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602149 Atlas Antibodies HPA028892 2026-08-29 06:50:01 0
Anti-ZNF470 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA029000, RRID:AB_10603843 ZNF470 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603843 Atlas Antibodies HPA029000 2026-08-31 06:04:05 0
Anti-AMFR polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA029018, RRID:AB_2672869 AMFR human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672869 Atlas Antibodies HPA029018 2026-08-31 12:46:49 0
Anti-PAN3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028817, RRID:AB_10602016 PAN3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602016 Atlas Antibodies HPA028817 2026-08-31 09:09:28 0
Anti-WDR26 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028539, RRID:AB_10669752 WDR26 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10669752 Atlas Antibodies HPA028539 2026-08-29 03:03:42 0
Anti-ZNF518A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA029049, RRID:AB_2672885 ZNF518A human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672885 Atlas Antibodies HPA029049 2026-08-28 03:57:16 0
Anti-UBXN10 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028555, RRID:AB_10600417 UBXN10 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600417 Atlas Antibodies HPA028555 2026-08-29 04:09:05 0
Anti-INPP5B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028803, RRID:AB_10612121 INPP5B human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10612121 Atlas Antibodies HPA028803 2026-08-31 04:32:31 0
Anti-TEAD3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028906, RRID:AB_10603347 TEAD3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603347 Atlas Antibodies HPA028906 2026-08-31 12:55:38 0
Anti-DYRK1B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028522, RRID:AB_2672656 DYRK1B human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672656 Atlas Antibodies HPA028522 2026-08-29 12:19:47 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch