Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854305
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): NAPG
Proper citation: Atlas Antibodies Cat# HPA008208, RRID:AB_1854305 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078073
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): A4GNT
Proper citation: Atlas Antibodies Cat# HPA008017, RRID:AB_1078073 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079540
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): OXSR1
Proper citation: Atlas Antibodies Cat# HPA008237, RRID:AB_1079540 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080209
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TBC1D10A
Proper citation: Atlas Antibodies Cat# HPA008142, RRID:AB_1080209 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079272
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LPGAT1
Proper citation: Atlas Antibodies Cat# HPA008304, RRID:AB_1079272 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856782
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SRSF11
Proper citation: Atlas Antibodies Cat# HPA008762, RRID:AB_1856782 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080270
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TPO
Proper citation: Atlas Antibodies Cat# HPA007987, RRID:AB_1080270 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852283
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM94
Proper citation: Atlas Antibodies Cat# HPA008423, RRID:AB_1852283 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080135
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SV2A
Proper citation: Atlas Antibodies Cat# HPA007863, RRID:AB_1080135 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078625
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): DAXX
Proper citation: Atlas Antibodies Cat# HPA008736, RRID:AB_1078625 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079273
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDM; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRAT
Proper citation: Atlas Antibodies Cat# HPA008397, RRID:AB_1079273 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849318
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GPRC5A
Proper citation: Atlas Antibodies Cat# HPA007928, RRID:AB_1849318 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852384
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM208A
Proper citation: Atlas Antibodies Cat# HPA006735, RRID:AB_1852384 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667726
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF131
Proper citation: Atlas Antibodies Cat# HPA007023, RRID:AB_2667726 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855278
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PHC1
Proper citation: Atlas Antibodies Cat# HPA006973, RRID:AB_1855278 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078493
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDK9
Proper citation: Atlas Antibodies Cat# HPA006738, RRID:AB_1078493 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844435
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ABCC9
Proper citation: Atlas Antibodies Cat# HPA007279, RRID:AB_1844435 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078820
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAAH
Proper citation: Atlas Antibodies Cat# HPA007425, RRID:AB_1078820 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080495
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): USP10
Proper citation: Atlas Antibodies Cat# HPA006731, RRID:AB_1080495 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079222
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KELPHQESRASQLQTLSDAHRKAYEIYHESYAFQGGKLSVVLRAEDIPELLLEPPISALAQDTVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVFIFNLKLPDCPSTMKNPASLLFSLFEAINKDQVLTIGFDINEFLSCSSSSKK; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): LCT
Proper citation: Atlas Antibodies Cat# HPA007408, RRID:AB_1079222 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.