Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Clonality:polyclonal (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

1,440,271 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Target Antigen

Sort Ascending

Sort Descending

 Target Organism

Sort Ascending

Sort Descending

 Clone ID
Defining Citation

Sort Ascending

Sort Descending

 Comments
Clonality

Sort Ascending

Sort Descending

 Host Organism

Sort Ascending

Sort Descending

 Antibody ID
Vendor

Sort Ascending

Sort Descending

 Catalog Number
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
Anti-PLCL2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047616, RRID:AB_2680105 PLCL2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680105 Atlas Antibodies HPA047616 2026-08-29 12:56:54 0
Anti-ZBTB12 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047161, RRID:AB_2679962 ZBTB12 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679962 Atlas Antibodies HPA047161 2026-08-29 01:09:09 0
Anti-DHX15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047047, RRID:AB_2679916 DHX15 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679916 Atlas Antibodies HPA047047 2026-08-29 08:08:05 0
Anti-IFNA6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047557, RRID:AB_2680087 IFNA6 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680087 Atlas Antibodies HPA047557 2026-08-29 07:07:47 0
Anti-C4orf46 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047287, RRID:AB_2680011 C4orf46 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680011 Atlas Antibodies HPA047287 2026-08-28 09:55:45 0
Anti-SCAND1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047138, RRID:AB_2679950 SCAND1 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679950 Atlas Antibodies HPA047138 2026-08-31 09:58:20 0
Anti-GPR180 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047250, RRID:AB_2679998 GPR180 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679998 Atlas Antibodies HPA047250 2026-08-28 04:03:42 0
Anti-HSD17B7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047496, RRID:AB_2680068 HSD17B7 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680068 Atlas Antibodies HPA047496 2026-08-28 11:06:36 0
Anti-GFRAL polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047372, RRID:AB_2680017 GFRAL human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDI; Manufacturer approved use: IHC polyclonal rabbit AB_2680017 Atlas Antibodies HPA047372 2026-08-29 05:06:01 0
Anti-NUP210L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047195, RRID:AB_2679980 NUP210L human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679980 Atlas Antibodies HPA047195 2026-08-29 07:16:30 0
Anti-NRDE2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047050, RRID:AB_2679917 NRDE2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679917 Atlas Antibodies HPA047050 2026-08-29 07:35:38 0
Anti-EXD3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047395, RRID:AB_10962864 EXD3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10962864 Atlas Antibodies HPA047395 2026-08-29 07:00:51 0
Anti-PTCD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047679, RRID:AB_2680119 PTCD1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680119 Atlas Antibodies HPA047679 2026-08-29 07:07:47 0
Anti-HSD11B1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Atlas Antibodies Cat# HPA047729, RRID:AB_2680135 HSD11B1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680135 Atlas Antibodies HPA047729 2026-08-28 10:28:47 1
Anti-NAT14 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047187, RRID:AB_2679974 NAT14 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679974 Atlas Antibodies HPA047187 2026-08-28 08:07:50 0
Anti-DHX37 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047607, RRID:AB_2680101 DHX37 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680101 Atlas Antibodies HPA047607 2026-08-29 09:40:58 0
Anti-USP54 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047663, RRID:AB_2680116 USP54 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680116 Atlas Antibodies HPA047663 2026-08-28 06:11:29 0
Anti-SH2D3C polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047586, RRID:AB_2680093 SH2D3C human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680093 Atlas Antibodies HPA047586 2026-08-31 10:26:17 0
Anti-MRPS17 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047159, RRID:AB_2679961 MRPS17 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679961 Atlas Antibodies HPA047159 2026-08-28 06:25:35 0
Anti-RPL36 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047153, RRID:AB_2679958 RPL36 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679958 Atlas Antibodies HPA047153 2026-08-28 06:35:18 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch