Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678042
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RNF207
Proper citation: Atlas Antibodies Cat# HPA042535, RRID:AB_2678042 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794797
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SCD5
Proper citation: Atlas Antibodies Cat# HPA042380, RRID:AB_10794797 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678145
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EFCAB8
Proper citation: Atlas Antibodies Cat# HPA042751, RRID:AB_2678145 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10797018
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PKIG
Proper citation: Atlas Antibodies Cat# HPA042703, RRID:AB_10797018 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678107
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CYB5RL
Proper citation: Atlas Antibodies Cat# HPA042671, RRID:AB_2678107 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794276
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LHFPL2
Proper citation: Atlas Antibodies Cat# HPA042402, RRID:AB_10794276 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960998
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UQCRH
Proper citation: Atlas Antibodies Cat# HPA042574, RRID:AB_10960998 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10806243
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MEMO1
Proper citation: Atlas Antibodies Cat# HPA042603, RRID:AB_10806243 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794914
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ENHO
Proper citation: Atlas Antibodies Cat# HPA042575, RRID:AB_10794914 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678135
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): WDFY3
Proper citation: Atlas Antibodies Cat# HPA042734, RRID:AB_2678135 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795503
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM263
Proper citation: Atlas Antibodies Cat# HPA042339, RRID:AB_10795503 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677929
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BCAR1
Proper citation: Atlas Antibodies Cat# HPA042282, RRID:AB_2677929 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796577
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ELOVL6
Proper citation: Atlas Antibodies Cat# HPA042355, RRID:AB_10796577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677955
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLDN10
Proper citation: Atlas Antibodies Cat# HPA042348, RRID:AB_2677955 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796581
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): S100A3
Proper citation: Atlas Antibodies Cat# HPA042674, RRID:AB_10796581 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678104
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GAPDHS
Proper citation: Atlas Antibodies Cat# HPA042666, RRID:AB_2678104 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677917
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVS; Manufacturer approved use: ICC-IF, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): CNR1
Proper citation: Atlas Antibodies Cat# HPA042256, RRID:AB_2677917 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678098
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM210B
Proper citation: Atlas Antibodies Cat# HPA042652, RRID:AB_2678098 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10806232
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NUDT7
Proper citation: Atlas Antibodies Cat# HPA042042, RRID:AB_10806232 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794641
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IGLON5
Proper citation: Atlas Antibodies Cat# HPA041994, RRID:AB_10794641 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.