Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674524
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): IKZF1
Proper citation: Atlas Antibodies Cat# HPA035221, RRID:AB_2674524 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674441
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HIKESHI
Proper citation: Atlas Antibodies Cat# HPA035064, RRID:AB_2674441 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669900
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GCA
Proper citation: Atlas Antibodies Cat# HPA035034, RRID:AB_10669900 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601763
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KANSL3
Proper citation: Atlas Antibodies Cat# HPA035018, RRID:AB_10601763 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674548
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC14
Proper citation: Atlas Antibodies Cat# HPA035278, RRID:AB_2674548 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672865
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ECT2L
Proper citation: Atlas Antibodies Cat# HPA035488, RRID:AB_10672865 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674597
Comments: Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): NDUFAF3
Proper citation: Atlas Antibodies Cat# HPA035376, RRID:AB_2674597 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671511
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL1RAP
Proper citation: Atlas Antibodies Cat# HPA035293, RRID:AB_10671511 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959451
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SEC13
Proper citation: Atlas Antibodies Cat# HPA035292, RRID:AB_10959451 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674492
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PHLDB2
Proper citation: Atlas Antibodies Cat# HPA035147, RRID:AB_2674492 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669899
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KLHL18
Proper citation: Atlas Antibodies Cat# HPA035028, RRID:AB_10669899 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674477
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC9A2
Proper citation: Atlas Antibodies Cat# HPA035122, RRID:AB_2674477 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601928
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNT; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZMYND10
Proper citation: Atlas Antibodies Cat# HPA035255, RRID:AB_10601928 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673219
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): NDUFAF3
Proper citation: Atlas Antibodies Cat# HPA035377, RRID:AB_10673219 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794630
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC30A5
Proper citation: Atlas Antibodies Cat# HPA035373, RRID:AB_10794630 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674577
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SLC25A12
Proper citation: Atlas Antibodies Cat# HPA035334, RRID:AB_2674577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674497
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF792
Proper citation: Atlas Antibodies Cat# HPA035157, RRID:AB_2674497 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601154
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RABL3
Proper citation: Atlas Antibodies Cat# HPA035151, RRID:AB_10601154 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671932
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): STX10
Proper citation: Atlas Antibodies Cat# HPA035303, RRID:AB_10671932 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674468
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C21orf58
Proper citation: Atlas Antibodies Cat# HPA035111, RRID:AB_2674468 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.