Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 388 showing 7741 ~ 7760 out of 1,440,255 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678344

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TGGNLDRHTASKPTALLQPGPGWQRGAACCLQILPESRVCFPTGLPLARKVTKLSWVGYKLQGRELQWPVYREELELERLLW; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): AC009065.4

Proper citation: Atlas Antibodies Cat# HPA043155, RRID:AB_2678344 Copy   

    • RRID:AB_10794923

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794923

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): INO80E

Proper citation: Atlas Antibodies Cat# HPA043146, RRID:AB_10794923 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678290

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): STRN4

Proper citation: Atlas Antibodies Cat# HPA043051, RRID:AB_2678290 Copy   

    • RRID:AB_2678201

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678201

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SRRT

Proper citation: Atlas Antibodies Cat# HPA042858, RRID:AB_2678201 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964270

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CSPG4

Proper citation: Atlas Antibodies Cat# HPA042785, RRID:AB_10964270 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678277

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARMCX6

Proper citation: Atlas Antibodies Cat# HPA043030, RRID:AB_2678277 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794920

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C16orf62

Proper citation: Atlas Antibodies Cat# HPA042969, RRID:AB_10794920 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678386

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NCOR1

Proper citation: Atlas Antibodies Cat# HPA043246, RRID:AB_2678386 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794767

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC157

Proper citation: Atlas Antibodies Cat# HPA042943, RRID:AB_10794767 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10806378

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SMIM7

Proper citation: Atlas Antibodies Cat# HPA043127, RRID:AB_10806378 Copy   

    • RRID:AB_2678222

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678222

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DBF4

Proper citation: Atlas Antibodies Cat# HPA042923, RRID:AB_2678222 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795514

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PODNL1

Proper citation: Atlas Antibodies Cat# HPA042807, RRID:AB_10795514 Copy   

    • RRID:AB_10794771

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794771

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IRX1

Proper citation: Atlas Antibodies Cat# HPA043160, RRID:AB_10794771 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678254

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPCPD1

Proper citation: Atlas Antibodies Cat# HPA042987, RRID:AB_2678254 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678179

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): YPEL5

Proper citation: Atlas Antibodies Cat# HPA042809, RRID:AB_2678179 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678293

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GSKIP

Proper citation: Atlas Antibodies Cat# HPA043054, RRID:AB_2678293 Copy   

    • RRID:AB_2678227

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678227

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DTX2

Proper citation: Atlas Antibodies Cat# HPA042931, RRID:AB_2678227 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10797508

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NDUFB9

Proper citation: Atlas Antibodies Cat# HPA042768, RRID:AB_10797508 Copy   

    • RRID:AB_2678284

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678284

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HAGH

Proper citation: Atlas Antibodies Cat# HPA043041, RRID:AB_2678284 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794535

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ADAMTS15

Proper citation: Atlas Antibodies Cat# HPA042867, RRID:AB_10794535 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch