Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 386 showing 7701 ~ 7720 out of 1,440,255 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678376

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GAGE1

Proper citation: Atlas Antibodies Cat# HPA043232, RRID:AB_2678376 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678264

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAP1LC3A

Proper citation: Atlas Antibodies Cat# HPA043000, RRID:AB_2678264 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10793991

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FILIP1L

Proper citation: Atlas Antibodies Cat# HPA043133, RRID:AB_10793991 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678217

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATP6V1G1

Proper citation: Atlas Antibodies Cat# HPA042898, RRID:AB_2678217 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10793990

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): WDR41

Proper citation: Atlas Antibodies Cat# HPA043124, RRID:AB_10793990 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678391

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LIN37

Proper citation: Atlas Antibodies Cat# HPA043253, RRID:AB_2678391 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794924

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCRL2

Proper citation: Atlas Antibodies Cat# HPA043238, RRID:AB_10794924 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964436

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRIM43

Proper citation: Atlas Antibodies Cat# HPA042772, RRID:AB_10964436 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678316

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KANSL1L

Proper citation: Atlas Antibodies Cat# HPA043102, RRID:AB_2678316 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10962511

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C5orf63

Proper citation: Atlas Antibodies Cat# HPA043240, RRID:AB_10962511 Copy   

    • RRID:AB_2678363

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678363

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC6A19

Proper citation: Atlas Antibodies Cat# HPA043207, RRID:AB_2678363 Copy   

    • RRID:AB_10794918

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794918

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PEX3

Proper citation: Atlas Antibodies Cat# HPA042830, RRID:AB_10794918 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964776

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AKAP17A

Proper citation: Atlas Antibodies Cat# HPA043247, RRID:AB_10964776 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794922

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ABCC12

Proper citation: Atlas Antibodies Cat# HPA043100, RRID:AB_10794922 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678267

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RASA4

Proper citation: Atlas Antibodies Cat# HPA043010, RRID:AB_2678267 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678341

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPRIN3

Proper citation: Atlas Antibodies Cat# HPA043148, RRID:AB_2678341 Copy   

    • RRID:AB_10797137

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10797137

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FSD1

Proper citation: Atlas Antibodies Cat# HPA043141, RRID:AB_10797137 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678280

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RNASEH1

Proper citation: Atlas Antibodies Cat# HPA043037, RRID:AB_2678280 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10793985

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MT-CO3

Proper citation: Atlas Antibodies Cat# HPA042788, RRID:AB_10793985 Copy   

    • RRID:AB_10964890

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964890

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DPH6

Proper citation: Atlas Antibodies Cat# HPA042976, RRID:AB_10964890 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch