Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672082
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC35C2
Proper citation: Atlas Antibodies Cat# HPA027011, RRID:AB_2672082 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599301
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): NUP43
Proper citation: Atlas Antibodies Cat# HPA027126, RRID:AB_10599301 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10610704
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF503
Proper citation: Atlas Antibodies Cat# HPA026848, RRID:AB_10610704 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859459
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF804B
Proper citation: Atlas Antibodies Cat# HPA026702, RRID:AB_1859459 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2067139
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DIEXF
Proper citation: Atlas Antibodies Cat# HPA026640, RRID:AB_2067139 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853961
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MINPP1
Proper citation: Atlas Antibodies Cat# HPA026859, RRID:AB_1853961 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672032
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EMC4
Proper citation: Atlas Antibodies Cat# HPA026868, RRID:AB_2672032 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853685
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MDH2
Proper citation: Atlas Antibodies Cat# HPA026720, RRID:AB_1853685 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853911
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): FAM221A
Proper citation: Atlas Antibodies Cat# HPA026748, RRID:AB_1853911 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848942
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMPPE
Proper citation: Atlas Antibodies Cat# HPA027019, RRID:AB_1848942 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856633
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SCP2
Proper citation: Atlas Antibodies Cat# HPA027135, RRID:AB_1856633 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601824
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): TMEM69
Proper citation: Atlas Antibodies Cat# HPA026993, RRID:AB_10601824 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858733
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTH; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): VDAC3
Proper citation: Atlas Antibodies Cat# HPA026864, RRID:AB_1858733 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858360
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAY; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRPA1
Proper citation: Atlas Antibodies Cat# HPA026630, RRID:AB_1858360 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844834
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANKMY1
Proper citation: Atlas Antibodies Cat# HPA026620, RRID:AB_1844834 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2671920
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): VWDE
Proper citation: Atlas Antibodies Cat# HPA026619, RRID:AB_2671920 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601696
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KNL1
Proper citation: Atlas Antibodies Cat# HPA026624, RRID:AB_10601696 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854580
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NPC1
Proper citation: Atlas Antibodies Cat# HPA026618, RRID:AB_1854580 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855725
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ERI3
Proper citation: Atlas Antibodies Cat# HPA027147, RRID:AB_1855725 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854077
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MPHOSPH6
Proper citation: Atlas Antibodies Cat# HPA026948, RRID:AB_1854077 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
