Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Validation:information available (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Target Antigen

Sort Ascending

Sort Descending

 Target Organism

Sort Ascending

Sort Descending

 Clone ID
Defining Citation

Sort Ascending

Sort Descending

 Comments
Clonality

Sort Ascending

Sort Descending

 Host Organism

Sort Ascending

Sort Descending

 Antibody ID
Vendor

Sort Ascending

Sort Descending

 Catalog Number
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
Anti-SAMD15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030673, RRID:AB_10600655 SAMD15 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600655 Atlas Antibodies HPA030673 2025-08-19 03:20:12 0
Anti-GIGYF1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA023995, RRID:AB_1855221 GIGYF1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1855221 Atlas Antibodies HPA023995 2025-08-19 03:20:11 0
Anti-ANXA13
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA018535, RRID:AB_1844854 ANXA13 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1844854 Atlas Antibodies HPA018535 2025-08-19 03:20:11 0
Anti-JTB
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA006514, RRID:AB_1079164 JTB human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1079164 Atlas Antibodies HPA006514 2025-08-19 03:20:23 0
Anti-LRRC37B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA015134, RRID:AB_1853311 LRRC37B human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CKTVKLHCNTACLTNSIHCPEEASVGNPEGAFMKMLQARKQHMSTQLTIESEAPSDSSGINLSGFGGDQLEIQLTEQLRSLIPNEDVRKFMSHVIRTLK; Manufacturer approved use: IHC polyclonal rabbit AB_1853311 Atlas Antibodies HPA015134 2025-08-19 03:20:11 0
Anti-RET polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Atlas Antibodies Cat# HPA008356, RRID:AB_1847232 RET human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1847232 Atlas Antibodies HPA008356 2025-08-19 03:20:11 1
Anti-DPEP1
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Atlas Antibodies Cat# HPA009426, RRID:AB_1847842 DPEP1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1847842 Atlas Antibodies HPA009426 2025-08-19 03:20:23 1
Rabbit Anti-alpha Tubulin Monoclonal Antibody, Unconjugated, Clone EP1332Y
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Millipore Cat# 04-1117, RRID:AB_1977540 alpha Tubulin rat, mouse, human Clone EP1332Y seller recommendations: Immunocytochemistry; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunohistochemistry (Paraffin), Western Blotting, Immunocytochemistry, Immunoprecipitation monoclonal rabbit AB_1977540 Millipore 04-1117 2025-08-19 03:19:11 1
Anti-EMILIN1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Sigma-Aldrich Cat# HPA002822, RRID:AB_1078738 EMILIN1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot polyclonal rabbit AB_1078738 Sigma-Aldrich HPA002822 2025-08-19 03:18:50 1
Fos B (102)
 
Resource Report
Resource Website
10+ mentions
Discontinued
Rating or validation data 		Santa Cruz Biotechnology Cat# sc-48, RRID:AB_631515 Fos B (102) Human, Rat, Mouse PMID:19399877
PMID:19235223 		Discontinued: 2016; validation status unknown check with seller; recommendations: IgY Western Blot; Immunofluorescence; Immunohistochemistry; Immunoprecipitation; ELISA; Immunocytochemistry; WB, IP, IF, IHC(P), ELISA polyclonal human AB_631515 Santa Cruz Biotechnology sc-48 2025-08-19 03:19:47 15
Anti-GRAMD3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA010095, RRID:AB_1849952 GRAMD3 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1849952 Sigma-Aldrich HPA010095 2025-08-19 03:19:08 0
Anti-GHRL antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA014246, RRID:AB_1849659 Human GHRL human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1849659 Sigma-Aldrich HPA014246 2025-08-19 03:19:07 0
Anti-HECW1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA007593, RRID:AB_1852305 HECW1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1852305 Atlas Antibodies HPA007593 2025-08-19 03:19:18 0
Anti-HEPH antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA005824, RRID:AB_1850603 Human HEPH human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1850603 Sigma-Aldrich HPA005824 2025-08-19 03:19:21 0
Anti-PHRF1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA019867, RRID:AB_1852416 Human PHRF1 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1852416 Sigma-Aldrich HPA019867 2025-08-19 03:19:56 0
Anti-FAM73A antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA017589, RRID:AB_1848409 Human FAM73A human Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1848409 Sigma-Aldrich HPA017589 2025-08-19 03:19:20 0
Anti-THRA antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA009654, RRID:AB_1854603 THRA antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1854603 Sigma-Aldrich HPA009654 2025-08-19 03:19:33 0
Anti-LRRC3B antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA015568, RRID:AB_1853282 Human LRRC3B human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1853282 Sigma-Aldrich HPA015568 2025-08-19 03:19:57 0
Anti-SLC22A15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA019785, RRID:AB_1857011 SLC22A15 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1857011 Atlas Antibodies HPA019785 2025-08-19 03:19:29 0
Anti-THOC5 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA029812, RRID:AB_10603455 THOC5 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10603455 Sigma-Aldrich HPA029812 2025-08-19 03:18:09 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

HIRN Funding Opportunity: SPARKS Award

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch