Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-SAMD15 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA030673, RRID:AB_10600655 | SAMD15 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10600655 | Atlas Antibodies | HPA030673 | 2025-08-19 03:20:12 | 0 | ||
|
Anti-GIGYF1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA023995, RRID:AB_1855221 | GIGYF1 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1855221 | Atlas Antibodies | HPA023995 | 2025-08-19 03:20:11 | 0 | ||
|
Anti-ANXA13 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA018535, RRID:AB_1844854 | ANXA13 | human | Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1844854 | Atlas Antibodies | HPA018535 | 2025-08-19 03:20:11 | 0 | ||
|
Anti-JTB Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006514, RRID:AB_1079164 | JTB | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1079164 | Atlas Antibodies | HPA006514 | 2025-08-19 03:20:23 | 0 | ||
|
Anti-LRRC37B polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA015134, RRID:AB_1853311 | LRRC37B | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CKTVKLHCNTACLTNSIHCPEEASVGNPEGAFMKMLQARKQHMSTQLTIESEAPSDSSGINLSGFGGDQLEIQLTEQLRSLIPNEDVRKFMSHVIRTLK; Manufacturer approved use: IHC | polyclonal | rabbit | AB_1853311 | Atlas Antibodies | HPA015134 | 2025-08-19 03:20:11 | 0 | ||
|
Anti-RET polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA008356, RRID:AB_1847232 | RET | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1847232 | Atlas Antibodies | HPA008356 | 2025-08-19 03:20:11 | 1 | ||
|
Anti-DPEP1 Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA009426, RRID:AB_1847842 | DPEP1 | human | Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1847842 | Atlas Antibodies | HPA009426 | 2025-08-19 03:20:23 | 1 | ||
|
Rabbit Anti-alpha Tubulin Monoclonal Antibody, Unconjugated, Clone EP1332Y Resource Report Resource Website 1+ mentions Rating or validation data |
Millipore Cat# 04-1117, RRID:AB_1977540 | alpha Tubulin | rat, mouse, human | Clone EP1332Y | seller recommendations: Immunocytochemistry; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunohistochemistry (Paraffin), Western Blotting, Immunocytochemistry, Immunoprecipitation | monoclonal | rabbit | AB_1977540 | Millipore | 04-1117 | 2025-08-19 03:19:11 | 1 | |
|
Anti-EMILIN1 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA002822, RRID:AB_1078738 | EMILIN1 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot | polyclonal | rabbit | AB_1078738 | Sigma-Aldrich | HPA002822 | 2025-08-19 03:18:50 | 1 | ||
|
Fos B (102) Resource Report Resource Website 10+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-48, RRID:AB_631515 | Fos B (102) | Human, Rat, Mouse |
PMID:19399877 PMID:19235223 |
Discontinued: 2016; validation status unknown check with seller; recommendations: IgY Western Blot; Immunofluorescence; Immunohistochemistry; Immunoprecipitation; ELISA; Immunocytochemistry; WB, IP, IF, IHC(P), ELISA | polyclonal | human | AB_631515 | Santa Cruz Biotechnology | sc-48 | 2025-08-19 03:19:47 | 15 | |
|
Anti-GRAMD3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA010095, RRID:AB_1849952 | GRAMD3 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1849952 | Sigma-Aldrich | HPA010095 | 2025-08-19 03:19:08 | 0 | ||
|
Anti-GHRL antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA014246, RRID:AB_1849659 | Human GHRL | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1849659 | Sigma-Aldrich | HPA014246 | 2025-08-19 03:19:07 | 0 | ||
|
Anti-HECW1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA007593, RRID:AB_1852305 | HECW1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1852305 | Atlas Antibodies | HPA007593 | 2025-08-19 03:19:18 | 0 | ||
|
Anti-HEPH antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA005824, RRID:AB_1850603 | Human HEPH | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1850603 | Sigma-Aldrich | HPA005824 | 2025-08-19 03:19:21 | 0 | ||
|
Anti-PHRF1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA019867, RRID:AB_1852416 | Human PHRF1 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1852416 | Sigma-Aldrich | HPA019867 | 2025-08-19 03:19:56 | 0 | ||
|
Anti-FAM73A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA017589, RRID:AB_1848409 | Human FAM73A | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1848409 | Sigma-Aldrich | HPA017589 | 2025-08-19 03:19:20 | 0 | ||
|
Anti-THRA antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA009654, RRID:AB_1854603 | THRA antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1854603 | Sigma-Aldrich | HPA009654 | 2025-08-19 03:19:33 | 0 | ||
|
Anti-LRRC3B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA015568, RRID:AB_1853282 | Human LRRC3B | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1853282 | Sigma-Aldrich | HPA015568 | 2025-08-19 03:19:57 | 0 | ||
|
Anti-SLC22A15 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA019785, RRID:AB_1857011 | SLC22A15 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1857011 | Atlas Antibodies | HPA019785 | 2025-08-19 03:19:29 | 0 | ||
|
Anti-THOC5 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA029812, RRID:AB_10603455 | THOC5 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10603455 | Sigma-Aldrich | HPA029812 | 2025-08-19 03:18:09 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.