Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600655
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SAMD15
Proper citation: Atlas Antibodies Cat# HPA030673, RRID:AB_10600655 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855221
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GIGYF1
Proper citation: Atlas Antibodies Cat# HPA023995, RRID:AB_1855221 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844854
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ANXA13
Proper citation: Atlas Antibodies Cat# HPA018535, RRID:AB_1844854 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079164
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): JTB
Proper citation: Atlas Antibodies Cat# HPA006514, RRID:AB_1079164 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853311
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CKTVKLHCNTACLTNSIHCPEEASVGNPEGAFMKMLQARKQHMSTQLTIESEAPSDSSGINLSGFGGDQLEIQLTEQLRSLIPNEDVRKFMSHVIRTLK; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRRC37B
Proper citation: Atlas Antibodies Cat# HPA015134, RRID:AB_1853311 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847232
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RET
Proper citation: Atlas Antibodies Cat# HPA008356, RRID:AB_1847232 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847842
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): DPEP1
Proper citation: Atlas Antibodies Cat# HPA009426, RRID:AB_1847842 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1977540
Comments: seller recommendations: Immunocytochemistry; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunohistochemistry (Paraffin), Western Blotting, Immunocytochemistry, Immunoprecipitation
Host Organism: rabbit
Clonality: monoclonal
Target(s): alpha Tubulin
Proper citation: Millipore Cat# 04-1117, RRID:AB_1977540 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078738
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): EMILIN1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA002822, RRID:AB_1078738 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_631515
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: IgY Western Blot; Immunofluorescence; Immunohistochemistry; Immunoprecipitation; ELISA; Immunocytochemistry; WB, IP, IF, IHC(P), ELISA
Host Organism: human
Clonality: polyclonal
Target(s): Fos B (102)
Proper citation: Santa Cruz Biotechnology Cat# sc-48, RRID:AB_631515 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849952
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GRAMD3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA010095, RRID:AB_1849952 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849659
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human GHRL
Proper citation: Sigma-Aldrich Cat# HPA014246, RRID:AB_1849659 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852305
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HECW1
Proper citation: Atlas Antibodies Cat# HPA007593, RRID:AB_1852305 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1850603
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human HEPH
Proper citation: Sigma-Aldrich Cat# HPA005824, RRID:AB_1850603 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852416
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human PHRF1
Proper citation: Sigma-Aldrich Cat# HPA019867, RRID:AB_1852416 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848409
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human FAM73A
Proper citation: Sigma-Aldrich Cat# HPA017589, RRID:AB_1848409 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854603
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): THRA antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA009654, RRID:AB_1854603 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853282
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human LRRC3B
Proper citation: Sigma-Aldrich Cat# HPA015568, RRID:AB_1853282 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857011
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC22A15
Proper citation: Atlas Antibodies Cat# HPA019785, RRID:AB_1857011 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603455
Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): THOC5 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA029812, RRID:AB_10603455 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.