Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Clonality:polyclonal (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

1,440,255 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Target Antigen

Sort Ascending

Sort Descending

 Target Organism

Sort Ascending

Sort Descending

 Clone ID
Defining Citation

Sort Ascending

Sort Descending

 Comments
Clonality

Sort Ascending

Sort Descending

 Host Organism

Sort Ascending

Sort Descending

 Antibody ID
Vendor

Sort Ascending

Sort Descending

 Catalog Number
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
Anti-NCOA7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030291, RRID:AB_10669597 NCOA7 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10669597 Atlas Antibodies HPA030291 2026-08-29 12:56:51 0
Anti-NT5DC1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030352, RRID:AB_2154066 NT5DC1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2154066 Atlas Antibodies HPA030352 2026-08-29 02:41:44 0
Anti-YKT6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030818, RRID:AB_10602102 YKT6 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM; Manufacturer approved use: ICC-IF, IHC, WB polyclonal rabbit AB_10602102 Atlas Antibodies HPA030818 2026-08-29 10:37:16 0
Anti-RCHY1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030339, RRID:AB_10603232 RCHY1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603232 Atlas Antibodies HPA030339 2026-08-28 10:28:45 0
Anti-PSCA polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030783, RRID:AB_2673611 PSCA human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2673611 Atlas Antibodies HPA030783 2026-08-31 12:46:56 0
Anti-PSEN1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Atlas Antibodies Cat# HPA030760, RRID:AB_10696211 PSEN1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10696211 Atlas Antibodies HPA030760 2026-08-29 09:00:53 1
Anti-AIFM1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030611, RRID:AB_2673549 AIFM1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2673549 Atlas Antibodies HPA030611 2026-08-28 04:54:38 0
Anti-JAG2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030636, RRID:AB_10602607 JAG2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602607 Atlas Antibodies HPA030636 2026-08-31 09:58:17 0
Anti-MFN2 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Atlas Antibodies Cat# HPA030554, RRID:AB_10603018 MFN2 rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603018 Atlas Antibodies HPA030554 2026-08-29 07:36:26 1
Anti-LPIN2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030550, RRID:AB_2673519 LPIN2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2673519 Atlas Antibodies HPA030550 2026-08-31 11:33:21 0
Anti-DLGAP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030320, RRID:AB_10600904 DLGAP2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600904 Atlas Antibodies HPA030320 2026-08-28 06:02:23 0
Anti-SYTL3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030584, RRID:AB_10600196 SYTL3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600196 Atlas Antibodies HPA030584 2026-08-29 06:42:01 0
Anti-RFLNB
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030879, RRID:AB_2673643 RFLNB human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2673643 Atlas Antibodies HPA030879 2026-08-28 05:29:27 0
Anti-VDAC1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Atlas Antibodies Cat# HPA030780, RRID:AB_2673608 VDAC1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2673608 Atlas Antibodies HPA030780 2026-08-29 02:04:24 1
Anti-LGR4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030267, RRID:AB_10610004 LGR4 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10610004 Atlas Antibodies HPA030267 2026-08-31 11:33:14 0
Anti-ARHGAP28 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030415, RRID:AB_10669598 ARHGAP28 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10669598 Atlas Antibodies HPA030415 2026-08-29 02:03:34 0
Anti-MTMR11 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030351, RRID:AB_10602185 MTMR11 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602185 Atlas Antibodies HPA030351 2026-08-31 12:47:29 0
Anti-RBFOX3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030790, RRID:AB_10602305 RBFOX3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602305 Atlas Antibodies HPA030790 2026-08-29 07:07:43 0
Anti-C2orf83 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030319, RRID:AB_10602112 C2orf83 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602112 Atlas Antibodies HPA030319 2026-08-29 07:07:42 0
Anti-ZFP30 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA030606, RRID:AB_10602684 ZFP30 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602684 Atlas Antibodies HPA030606 2026-08-31 01:48:21 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

HIRN Funding Opportunity: SPARKS Award

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch