Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 374 showing 7461 ~ 7480 out of 1,440,255 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

    • RRID:AB_2684082

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684082

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DCK

Proper citation: Atlas Antibodies Cat# HPA059609, RRID:AB_2684082 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684125

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM41A

Proper citation: Atlas Antibodies Cat# HPA059790, RRID:AB_2684125 Copy   

    • RRID:AB_2683977

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683977

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SNF8

Proper citation: Atlas Antibodies Cat# HPA059320, RRID:AB_2683977 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683908

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RALYL

Proper citation: Atlas Antibodies Cat# HPA059112, RRID:AB_2683908 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684050

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF280B

Proper citation: Atlas Antibodies Cat# HPA059519, RRID:AB_2684050 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684007

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): VWC2L

Proper citation: Atlas Antibodies Cat# HPA059414, RRID:AB_2684007 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684076

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM80

Proper citation: Atlas Antibodies Cat# HPA059592, RRID:AB_2684076 Copy   

    • RRID:AB_2684117

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684117

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKM; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAP

Proper citation: Atlas Antibodies Cat# HPA059739, RRID:AB_2684117 Copy   

    • RRID:AB_2683943

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683943

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GSRKERQVYSKAVNRLFGVEASGRRIWIRRAGGRCLWRDDLLEPATKPSIAGKFKVLEPPMLGHDLRLALCLANLTSRAQRVRVNLSGATILYTR; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): TGM6

Proper citation: Atlas Antibodies Cat# HPA059196, RRID:AB_2683943 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683957

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): N6AMT1

Proper citation: Atlas Antibodies Cat# HPA059242, RRID:AB_2683957 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684111

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MYO19

Proper citation: Atlas Antibodies Cat# HPA059715, RRID:AB_2684111 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683945

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NOP10

Proper citation: Atlas Antibodies Cat# HPA059198, RRID:AB_2683945 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683932

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF684

Proper citation: Atlas Antibodies Cat# HPA059153, RRID:AB_2683932 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683912

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): COX7A2L

Proper citation: Atlas Antibodies Cat# HPA059124, RRID:AB_2683912 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684147

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAB21L1

Proper citation: Atlas Antibodies Cat# HPA059864, RRID:AB_2684147 Copy   

    • RRID:AB_2683940

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683940

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NNMT

Proper citation: Atlas Antibodies Cat# HPA059180, RRID:AB_2683940 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683988

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF485

Proper citation: Atlas Antibodies Cat# HPA059356, RRID:AB_2683988 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684020

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HOXD12

Proper citation: Atlas Antibodies Cat# HPA059444, RRID:AB_2684020 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683920

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CLDSFGLTNDFVVKLKVQGVNSQCHS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): IGFL2

Proper citation: Atlas Antibodies Cat# HPA059137, RRID:AB_2683920 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684027

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): OR4P4

Proper citation: Atlas Antibodies Cat# HPA059458, RRID:AB_2684027 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch