Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852324
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRRC2B
Proper citation: Atlas Antibodies Cat# HPA021022, RRID:AB_1852324 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845694
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MIS18A
Proper citation: Atlas Antibodies Cat# HPA020585, RRID:AB_1845694 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673840
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UBXN11
Proper citation: Atlas Antibodies Cat# HPA031357, RRID:AB_2673840 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602128
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EIF3M
Proper citation: Atlas Antibodies Cat# HPA031063, RRID:AB_10602128 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673712
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MCM4
Proper citation: Atlas Antibodies Cat# HPA031052, RRID:AB_2673712 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601587
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KDM1B
Proper citation: Atlas Antibodies Cat# HPA031269, RRID:AB_10601587 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611531
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SGKEETVQFDVQKLRIYCDPEQNNRETACEIPGFNGECLNGPSDVGSTPAPCICPPGKPGLQGPKGDPGLPGNPGYPGQPGQDGK; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): COL21A1
Proper citation: Atlas Antibodies Cat# HPA031213, RRID:AB_10611531 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673862
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RMND1
Proper citation: Atlas Antibodies Cat# HPA031398, RRID:AB_2673862 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601924
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KMO
Proper citation: Atlas Antibodies Cat# HPA031115, RRID:AB_10601924 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603941
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF772
Proper citation: Atlas Antibodies Cat# HPA031312, RRID:AB_10603941 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602010
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MX1
Proper citation: Atlas Antibodies Cat# HPA030917, RRID:AB_10602010 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673666
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BRWD1
Proper citation: Atlas Antibodies Cat# HPA030943, RRID:AB_2673666 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673855
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PREP
Proper citation: Atlas Antibodies Cat# HPA031388, RRID:AB_2673855 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669874
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SH3YL1
Proper citation: Atlas Antibodies Cat# HPA030927, RRID:AB_10669874 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603939
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF620
Proper citation: Atlas Antibodies Cat# HPA031452, RRID:AB_10603939 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602240
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KCNJ8
Proper citation: Atlas Antibodies Cat# HPA031066, RRID:AB_10602240 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599254
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): THEMIS2
Proper citation: Atlas Antibodies Cat# HPA031096, RRID:AB_10599254 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599973
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM83B
Proper citation: Atlas Antibodies Cat# HPA031464, RRID:AB_10599973 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601358
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLCN4
Proper citation: Atlas Antibodies Cat# HPA031313, RRID:AB_10601358 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671097
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RSPH4A
Proper citation: Atlas Antibodies Cat# HPA031197, RRID:AB_10671097 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.