Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-KTN1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003178, RRID:AB_1079218 KTN1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1079218 Atlas Antibodies HPA003178 2025-08-19 03:41:28 0
Anti-AC131097.4 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA043982, RRID:AB_10963048 AC131097.4 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10963048 Sigma-Aldrich HPA043982 2025-08-19 03:41:29 0
Anti-ZNF774 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA030840, RRID:AB_10602691 ZNF774 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10602691 Sigma-Aldrich HPA030840 2025-08-19 03:41:45 0
Anti-BCL10 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA017925, RRID:AB_1845312 BCL10 antibody produced in rabbit human Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1845312 Sigma-Aldrich HPA017925 2025-08-19 03:41:33 0
Anti-MRPL18 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA028775, RRID:AB_10601440 MRPL18 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other polyclonal rabbit AB_10601440 Sigma-Aldrich HPA028775 2025-08-19 03:41:44 0
Anti-LRRC8B antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA017950, RRID:AB_1853346 LRRC8B antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1853346 Sigma-Aldrich HPA017950 2025-08-19 03:41:49 0
HNRNPDL-human
 
Resource Report
Resource Website
Rating or validation data
Aviva Systems Biology Cat# ARP40585_T100, RRID:AB_2120669 HNRNPDL homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot QC10220 for not specified; status is not pursued; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615130, AB_2120669. unknown rabbit AB_2120669 Aviva Systems Biology ARP40585_T100 (also ENCAB000AVL) 2025-08-19 03:41:51 0
Anti-UTP23 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA044418, RRID:AB_10961139 UTP23 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10961139 Sigma-Aldrich HPA044418 2025-08-19 03:41:54 0
ARNT Antibody
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Thermo Fisher Scientific Cat# A302-764A, RRID:AB_10630100 ARNT human Discontinued; Applications: IHC (1:1,000-1:5,000), IP (2-5 µg/mg lysate) polyclonal rabbit AB_10630100 Thermo Fisher Scientific A302-764A (also A302-764A-T) 2025-08-19 03:44:24 0
Anti-KATNBL1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA062573, RRID:AB_2684796 KATNBL1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684796 Atlas Antibodies HPA062573 2025-08-19 03:46:08 0
Anti-FLRT3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056033, RRID:AB_2683016 FLRT3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683016 Atlas Antibodies HPA056033 2025-08-19 03:46:08 0
Anti-COMMD2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044190, RRID:AB_10966289 COMMD2 rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10966289 Atlas Antibodies HPA044190 2025-08-19 03:46:54 0
Anti-SLC12A1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA014967, RRID:AB_1854503 SLC12A1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1854503 Atlas Antibodies HPA014967 2025-08-19 03:46:07 0
Anti-STAU1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049892, RRID:AB_2680938 STAU1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680938 Atlas Antibodies HPA049892 2025-08-19 03:46:54 0
Anti-LRRC75A
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028528, RRID:AB_10600755 LRRC75A human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10600755 Atlas Antibodies HPA028528 2025-08-19 03:46:08 0
Anti-FOXB2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA067947, RRID:AB_2685930 FOXB2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685930 Atlas Antibodies HPA067947 2025-08-19 03:46:09 0
Anti-KCNN4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA053841, RRID:AB_2682278 KCNN4 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682278 Atlas Antibodies HPA053841 2025-08-19 03:46:08 0
Anti-WDR7 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051057, RRID:AB_2732563 WDR7 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732563 Atlas Antibodies HPA051057 2025-08-19 03:46:11 0
Anti-TMED3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049314, RRID:AB_2680708 TMED3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680708 Atlas Antibodies HPA049314 2025-08-19 03:46:49 0
Anti-CCDC89 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039351, RRID:AB_10673241 CCDC89 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KAEETHSSLSQELQARLQTVTREKEELLQLSIERGKVLQNKQAEICQLEEKLEIANEDRKHALERFEQEAVAVDSNLRVRELQRKVDGIQKAYDELRLQ; Manufacturer approved use: IHC, WB polyclonal rabbit AB_10673241 Atlas Antibodies HPA039351 2025-08-19 03:46:49 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.