Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-ANKFY1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA024522, RRID:AB_10601453 | ANKFY1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10601453 | Atlas Antibodies | HPA024522 | 2025-08-19 03:34:41 | 0 | ||
|
Anti-CLASP2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA067071, RRID:AB_2685775 | CLASP2 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2685775 | Atlas Antibodies | HPA067071 | 2025-08-19 03:34:42 | 0 | ||
|
Anti-ANKRD18A polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA051288, RRID:AB_2681421 | ANKRD18A | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2681421 | Atlas Antibodies | HPA051288 | 2025-08-19 03:35:04 | 0 | ||
|
Anti-DRC7 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA041521, RRID:AB_10795125 | DRC7 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPENFFIDPFTGHSYSTQDEHFLGIESLWNHKNYWINMQDCWNCCKDLIFDLGDPVRWEYMLLGTDKSQLSLTEEDDSGINDEDDVENLGKE; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10795125 | Atlas Antibodies | HPA041521 | 2025-08-19 03:35:04 | 0 | ||
|
Anti-ZNF629 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA056051, RRID:AB_2683020 | ZNF629 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2683020 | Atlas Antibodies | HPA056051 | 2025-08-19 03:35:04 | 0 | ||
|
APC anti-human CD206 (MMR) Resource Report Resource Website 1+ mentions Rating or validation data |
BioLegend Cat# 321109, RRID:AB_571884 | CD206 | human | Clone 15-2 | Applications: FC | monoclonal | mouse | AB_571884 | BioLegend | 321109 (also 321110) | 2025-08-19 03:35:09 | 3 | |
|
Anti-ABL1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA027280, RRID:AB_1844454 | ABL1 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1844454 | Sigma-Aldrich | HPA027280 | 2025-08-19 03:35:08 | 0 | ||
|
Anti-APOBEC2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA014252, RRID:AB_1844932 | APOBEC2 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1844932 | Sigma-Aldrich | HPA014252 | 2025-08-19 03:35:23 | 0 | ||
|
Living Colors® DsRed Polyclonal Antibody Resource Report Resource Website 500+ mentions Rating or validation data |
Takara Bio Cat# 632496, RRID:AB_10013483 | DsRed |
PMID:20575070 PMID:20878781 PMID:21713771 PMID:21935944 PMID:21452218 |
Applications: Western blotting, immunoprecipitation. Consolidation on 9/2016: AB_10015246 |
polyclonal | rabbit | AB_10013483 | Takara Bio | 632496 | 2025-08-19 03:40:54 | 585 | ||
|
Anti-GLCCI1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA001674, RRID:AB_1078971 | GLCCI1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_1078971 | Sigma-Aldrich | HPA001674 | 2025-08-19 03:40:57 | 0 | ||
|
CD3 Resource Report Resource Website Rating or validation data |
Spring Bioscience Cat# M3070, RRID:AB_1660771 | CD3 | ms, hu, mouse, human |
manufacturer recommendations: Clone: SP7 Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; IHC-P, WB Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE |
monoclonal | rabbit | AB_1660771 | Spring Bioscience | M3070 | 2025-08-19 03:41:01 | 0 | ||
|
Anti-ZNF367 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA015785, RRID:AB_2217750 | ZNF367 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot | polyclonal | rabbit | AB_2217750 | Sigma-Aldrich | HPA015785 | 2025-08-19 03:41:04 | 0 | ||
|
Anti-TCF4 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA025958, RRID:AB_1857849 | TCF4 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1857849 | Sigma-Aldrich | HPA025958 | 2025-08-19 03:41:04 | 0 | ||
|
Anti-SLC35A3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA015253, RRID:AB_1857106 | SLC35A3 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_1857106 | Sigma-Aldrich | HPA015253 | 2025-08-19 03:41:03 | 0 | ||
|
Anti-GPR22 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA012043, RRID:AB_1849289 | GPR22 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_1849289 | Sigma-Aldrich | HPA012043 | 2025-08-19 03:41:05 | 0 | ||
|
Anti-PEX19 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044837, RRID:AB_10962496 | PEX19 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10962496 | Sigma-Aldrich | HPA044837 | 2025-08-19 03:41:27 | 0 | |||
|
CD 195, C-C chemokine receptor type 5, (CCR5) Resource Report Resource Website Rating or validation data |
BD Biosciences Cat# 555991, RRID:AB_396277 | CD195 (CCR5) | human | [2D7/CCR5] |
Applications: Flow cytometry, Immunofluorescence Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_396277 | BD Biosciences | 555991 | 2025-08-19 03:41:25 | 0 | |
|
Anti-TRAPPC9 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA028262, RRID:AB_10603217 | TRAPPC9 antibody produced in rabbit | human | polyclonal | rabbit | AB_10603217 | Atlas Antibodies | HPA028262 | 2025-08-19 03:41:30 | 0 | |||
|
Anti-TMEM41B antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA014946, RRID:AB_2205037 | TMEM41B antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_2205037 | Sigma-Aldrich | HPA014946 | 2025-08-19 03:41:30 | 1 | ||
|
phospho-c-Fes (pTyr713) Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# SAB4504145, RRID:AB_2861328 | Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE | unknown | AB_2861328 | Sigma-Aldrich | SAB4504145 | 2025-08-19 03:41:34 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
