Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601453
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANKFY1
Proper citation: Atlas Antibodies Cat# HPA024522, RRID:AB_10601453 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685775
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLASP2
Proper citation: Atlas Antibodies Cat# HPA067071, RRID:AB_2685775 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681421
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANKRD18A
Proper citation: Atlas Antibodies Cat# HPA051288, RRID:AB_2681421 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795125
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPENFFIDPFTGHSYSTQDEHFLGIESLWNHKNYWINMQDCWNCCKDLIFDLGDPVRWEYMLLGTDKSQLSLTEEDDSGINDEDDVENLGKE; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): DRC7
Proper citation: Atlas Antibodies Cat# HPA041521, RRID:AB_10795125 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683020
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF629
Proper citation: Atlas Antibodies Cat# HPA056051, RRID:AB_2683020 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_571884
Comments: Applications: FC
Host Organism: mouse
Clonality: monoclonal
Target(s): CD206
Proper citation: BioLegend Cat# 321109, RRID:AB_571884 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844454
Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): ABL1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027280, RRID:AB_1844454 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844932
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): APOBEC2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA014252, RRID:AB_1844932 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10013483
Comments: Applications: Western blotting, immunoprecipitation.
Consolidation on 9/2016: AB_10015246
Host Organism: rabbit
Clonality: polyclonal
Target(s): DsRed
Proper citation: Takara Bio Cat# 632496, RRID:AB_10013483 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078971
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): GLCCI1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA001674, RRID:AB_1078971 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1660771
Comments: manufacturer recommendations: Clone: SP7 Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; IHC-P, WB
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: monoclonal
Target(s): CD3
Proper citation: Spring Bioscience Cat# M3070, RRID:AB_1660771 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2217750
Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF367 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015785, RRID:AB_2217750 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857849
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TCF4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA025958, RRID:AB_1857849 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857106
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC35A3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015253, RRID:AB_1857106 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849289
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPR22 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA012043, RRID:AB_1849289 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962496
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): PEX19 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044837, RRID:AB_10962496 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_396277
Comments: Applications: Flow cytometry, Immunofluorescence
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): CD195 (CCR5)
Proper citation: BD Biosciences Cat# 555991, RRID:AB_396277 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603217
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRAPPC9 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA028262, RRID:AB_10603217 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2205037
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM41B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA014946, RRID:AB_2205037 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2861328
Comments: Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Clonality: unknown
Proper citation: Sigma-Aldrich Cat# SAB4504145, RRID:AB_2861328 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
