Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
Antibody Name
Anti-TINAG polyclonal antibody
RRID:AB_2677276 RRID Copied  
PDF Report How to cite
Atlas Antibodies Cat# HPA041055, RRID:AB_2677276
Copy Citation Copied
Antibody Information

URL: http://antibodyregistry.org/AB_2677276

Proper Citation: Atlas Antibodies Cat# HPA041055, RRID:AB_2677276

Target Antigen: TINAG

Host Organism: rabbit

Clonality: polyclonal

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AKNRHGCNSGSIDRAWWYLRKRGLVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPN; Manufacturer approved use: ICC-IF

Expand All
Usage and Citation Metrics

We found {{ ctrl2.mentions.all_count }} mentions in open access literature.

We have not found any literature mentions for this resource.

We are searching literature mentions for this resource.

Most recent articles:

{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})

Checkfor all resource mentions.

Collaborator Network

A list of researchers who have used the resource and an author search tool

Find mentions based on location


{{ ctrl2.mentions.errors.location }}

A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.

Ratings and Alerts

No alerts have been found for Anti-TINAG polyclonal antibody.

View More at BIOMED RESOURCE WATCH

Data and Source Information
Authentication Plan

dkNET can assist you in preparing authentication plans for antibodies to comply with the NIH Submission Policy. The information can be used while planning your experiments or submitting grant applications. The authentication plan for antibodies is based on methods suggested in "A proposal for validation of antibodies" (Uhlen M et. al., 2016), the guideline published in the Journal of Comparative Neurology (Saper C, 2005)(2), and the example " Authentication of of Key Biological and/or Chemical Resources "(Bandrowski A). For best practices for authenticating antibodies, check our Authentication Reports services.