Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: AtALMT1-uPIC 3'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MLLASNFDTLSHFLQDFGDEYFEAREKGDYKVVEKRKKNLERYKSVLDSKSDEEALANYAEWEPPHGQFRFRHPWKQYVAVGALLRQCAYRIDALNSYINSDFQIPVDIKKKLETPLRRMSSESGNSMKEMSISLKQMIKSSSSDIHVSNSQAACKSLSTLLKSGILNDVEPLQMISLMTTVSMLIDIVNLTEKISESVHELASAARFKNKMRPTVLYEKSDSGSIGRAMPIDSHEDHHVVTVLHDVDNDRSNNVDDSRGGSSQDSCHHVAIKIVDDNSNHEKHEDGEIHVHTLSNGHLQALNLSSGENLYFQSVDHHHHHH-
Proper citation: RRID:Addgene_117888 Copy
Species: Arabidopsis thaliana
Genetic Insert: CHL1 wt
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117875 Copy
Species: Arabidopsis thaliana
Genetic Insert: CTP-CURT_fluoA
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Synthetic Biology, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117990 Copy
Species: Arabidopsis thaliana
Genetic Insert: CTP-CURT_fluoE
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Synthetic Biology, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117992 Copy
Species: Arabidopsis thaliana
Genetic Insert: CTP-CURT_fluoB
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Synthetic Biology, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117991 Copy
Species: Arabidopsis thaliana
Genetic Insert: CHL1 wt-eGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117876 Copy
Species: Arabidopsis thaliana
Genetic Insert: CHL1 T101D
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117879 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT6 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLLAVIVEWLAHSSILRGRGSTSRAKGLVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGFAVGFMLFGSTAFKNPSDDEKPFEQLENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117903 Copy
Species: Arabidopsis thaliana
Genetic Insert: CBL5-upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117869 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT6 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLLAVIVEWLAHSSILRGRGSTSRAKGLVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGFAVGFMLFGSTAFKNPSDDEKPFEQLENLYQSHHHHHH
Proper citation: RRID:Addgene_117902 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtPQL upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MIRDDLSLSLGIISVISWSVAEIPQIMTNYNQKSIEGVSITFLTTWMLGDIFNVVGCLMEPASLPVQFYTAVLYTLATLVLYVQSIYYGHIYPRLMKNRRNHQMVDVEEPLLREEAKRPSTKSLLCVVSVFLFLGSFNVLSGSRSMDLRGKDRVFVVGGAGARKLLEVSSGNLGENNNIGMWLGWAMAAIYMGGRLPQICMNVRRGNVEGLNPLMFFFAFIGNVTYVASILVNSVEWSKIEPNLPWLVDSGGCAVLDFLILLQFFYFHCRKVEADSVKKKHETGEEAVENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117897 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtPQL uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MIRDDLSLSLGIISVISWSVAEIPQIMTNYNQKSIEGVSITFLTTWMLGDIFNVVGCLMEPASLPVQFYTAVLYTLATLVLYVQSIYYGHIYPRLMKNRRNHQMVDVEEPLLREEAKRPSTKSLLCVVSVFLFLGSFNVLSGSRSMDLRGKDRVFVVGGAGARKLLEVSSGNLGENNNIGMWLGWAMAAIYMGGRLPQICMNVRRGNVEGLNPLMFFFAFIGNVTYVASILVNSVEWSKIEPNLPWLVDSGGCAVLDFLILLQFFYFHCRKVEADSVKKKHETGEEAVENLYQSHHHHHH
Proper citation: RRID:Addgene_117896 Copy
Species: Arabidopsis thaliana
Genetic Insert: CURT_flouB
Vector Backbone Description: Backbone Size:9228; Vector Backbone:pN_35S; Vector Types:Plant Expression, Yeast/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117995 Copy
Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoA
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:3956; Vector Backbone:pBAD; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117998 Copy
Species: Arabidopsis thaliana
Genetic Insert: CURT_flouD
Vector Backbone Description: Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_118001 Copy
Species: Arabidopsis thaliana
Genetic Insert: Derlin1-mOrange2
Vector Backbone Description: Backbone Size:2028; Vector Backbone:pN_35S/mCitrine (Addgene plasmid 117993); Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_118000 Copy
Species: Arabidopsis thaliana
Genetic Insert: OSCA1.1
Vector Backbone Description: Backbone Size:5286; Vector Backbone:pIRES2-mCherry; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30382938
Proper citation: RRID:Addgene_136592 Copy
Species: Arabidopsis thaliana
Genetic Insert: OSCA4.1
Vector Backbone Description: Backbone Size:5262; Vector Backbone:pIRES2-mCherry; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30382938
Proper citation: RRID:Addgene_136597 Copy
Species: Arabidopsis thaliana
Genetic Insert: mNeonGreen-Flag
Vector Backbone Description: Vector Backbone:pTN186; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32470363
Proper citation: RRID:Addgene_137082 Copy
Species: Arabidopsis thaliana
Genetic Insert: UBQ10 promoter
Vector Backbone Description: Backbone Size:2053; Vector Backbone:mUAV; Vector Types:Plant Expression; Bacterial Resistance:Chloramphenicol
Proper citation: RRID:Addgene_153363 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.