Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:mus musculus (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

12,978 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
mTalin2_R11
 
Resource Report
Resource Website 		RRID:Addgene_111044 TLN2 Mus musculus Ampicillin PMID:29723415 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_R7R8
 
Resource Report
Resource Website 		RRID:Addgene_111041 TLN2 Mus musculus Ampicillin PMID:27410476 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_R9
 
Resource Report
Resource Website 		RRID:Addgene_111042 TLN2 Mus musculus Ampicillin PMID:29723415 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_R13-DD
 
Resource Report
Resource Website 		RRID:Addgene_111047 TLN2 Mus musculus Ampicillin PMID:29723415 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_R12
 
Resource Report
Resource Website 		RRID:Addgene_111045 TLN2 Mus musculus Ampicillin PMID:29723415 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_R13
 
Resource Report
Resource Website 		RRID:Addgene_111046 TLN2 Mus musculus Ampicillin PMID:29723415 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_R1
 
Resource Report
Resource Website 		RRID:Addgene_111033 TLN2 Mus musculus Ampicillin PMID:29723415 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_F2
 
Resource Report
Resource Website 		RRID:Addgene_111030 TLN2 Mus musculus Ampicillin PMID:29723415 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_R4
 
Resource Report
Resource Website 		RRID:Addgene_111036 TLN2 Mus musculus Ampicillin PMID:29723415 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_R5
 
Resource Report
Resource Website 		RRID:Addgene_111037 TLN2 Mus musculus Ampicillin PMID:29723415 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
mTalin2_R7
 
Resource Report
Resource Website 		RRID:Addgene_111039 TLN2 Mus musculus Ampicillin PMID:27410476 Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:17 0
pJO428
 
Resource Report
Resource Website 		RRID:Addgene_111141 flag-lacZ25-119-DHFR-UbK48R-Val51-mIκBα Mus musculus Ampicillin PMID:24550490 Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:18 0
pCAG-Trex2-bpA-EF1BFP
 
Resource Report
Resource Website 		RRID:Addgene_111144 mouse Trex2 coding region Mus musculus Ampicillin PMID:30912045 Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:19 0
pJO427
 
Resource Report
Resource Website 		RRID:Addgene_111139 flag-lacZ25-119-DHFR-UbK48R-Glu51-mIκBα Mus musculus Ampicillin PMID:24550490 Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-05 12:44:18 0
EGFP-AR
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_111215 AR Mus musculus Kanamycin Backbone Marker:Clontech; Vector Backbone:Unknown; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-09-05 12:44:19 1
Prrx1:TFPnls-T2a-Cre-Ert
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_111150 TFPnls-T2a-Cre-Ert Mus musculus Ampicillin Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin wt 2026-09-05 12:44:19 1
Col1A2:TFPnls-T2a-mErt-Cre-Ert
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_111151 TFPnls-T2a-mErt-Cre-Ert Mus musculus Ampicillin Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin wt 2026-09-05 12:44:19 1
pET-30a(+)-Syk-tSH2
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_111269 murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form Mus musculus Kanamycin PMID:26468009 encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-05 12:44:20 1
pET-30a(+)-N-SH2
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_111274 murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site Mus musculus Kanamycin PMID:26468009 encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-05 12:44:20 1
pET-30a(+)-Syk-tSH2-FX
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_111272 murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker Mus musculus Kanamycin PMID:26468009 encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin interdomain A (Phe 119 to His 162) substituted by a flexible 20-amino-acid linker (GGS)3GS(GGS)3 2026-09-05 12:44:20 1

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch