Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
mTalin2_R11 Resource Report Resource Website |
RRID:Addgene_111044 | TLN2 | Mus musculus | Ampicillin | PMID:29723415 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_R7R8 Resource Report Resource Website |
RRID:Addgene_111041 | TLN2 | Mus musculus | Ampicillin | PMID:27410476 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_R9 Resource Report Resource Website |
RRID:Addgene_111042 | TLN2 | Mus musculus | Ampicillin | PMID:29723415 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_R13-DD Resource Report Resource Website |
RRID:Addgene_111047 | TLN2 | Mus musculus | Ampicillin | PMID:29723415 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_R12 Resource Report Resource Website |
RRID:Addgene_111045 | TLN2 | Mus musculus | Ampicillin | PMID:29723415 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_R13 Resource Report Resource Website |
RRID:Addgene_111046 | TLN2 | Mus musculus | Ampicillin | PMID:29723415 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_R1 Resource Report Resource Website |
RRID:Addgene_111033 | TLN2 | Mus musculus | Ampicillin | PMID:29723415 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_F2 Resource Report Resource Website |
RRID:Addgene_111030 | TLN2 | Mus musculus | Ampicillin | PMID:29723415 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_R4 Resource Report Resource Website |
RRID:Addgene_111036 | TLN2 | Mus musculus | Ampicillin | PMID:29723415 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_R5 Resource Report Resource Website |
RRID:Addgene_111037 | TLN2 | Mus musculus | Ampicillin | PMID:29723415 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
mTalin2_R7 Resource Report Resource Website |
RRID:Addgene_111039 | TLN2 | Mus musculus | Ampicillin | PMID:27410476 | Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:17 | 0 | ||
|
pJO428 Resource Report Resource Website |
RRID:Addgene_111141 | flag-lacZ25-119-DHFR-UbK48R-Val51-mIκBα | Mus musculus | Ampicillin | PMID:24550490 | Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:18 | 0 | ||
|
pCAG-Trex2-bpA-EF1BFP Resource Report Resource Website |
RRID:Addgene_111144 | mouse Trex2 coding region | Mus musculus | Ampicillin | PMID:30912045 | Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:19 | 0 | ||
|
pJO427 Resource Report Resource Website |
RRID:Addgene_111139 | flag-lacZ25-119-DHFR-UbK48R-Glu51-mIκBα | Mus musculus | Ampicillin | PMID:24550490 | Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:18 | 0 | ||
|
EGFP-AR Resource Report Resource Website 1+ mentions |
RRID:Addgene_111215 | AR | Mus musculus | Kanamycin | Backbone Marker:Clontech; Vector Backbone:Unknown; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-09-05 12:44:19 | 1 | |||
|
Prrx1:TFPnls-T2a-Cre-Ert Resource Report Resource Website 1+ mentions |
RRID:Addgene_111150 | TFPnls-T2a-Cre-Ert | Mus musculus | Ampicillin | Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin | wt | 2026-09-05 12:44:19 | 1 | ||
|
Col1A2:TFPnls-T2a-mErt-Cre-Ert Resource Report Resource Website 1+ mentions |
RRID:Addgene_111151 | TFPnls-T2a-mErt-Cre-Ert | Mus musculus | Ampicillin | Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin | wt | 2026-09-05 12:44:19 | 1 | ||
|
pET-30a(+)-Syk-tSH2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111269 | murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form | Mus musculus | Kanamycin | PMID:26468009 | encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ | Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-09-05 12:44:20 | 1 | |
|
pET-30a(+)-N-SH2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111274 | murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site | Mus musculus | Kanamycin | PMID:26468009 | encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG | Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-09-05 12:44:20 | 1 | |
|
pET-30a(+)-Syk-tSH2-FX Resource Report Resource Website 1+ mentions |
RRID:Addgene_111272 | murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker | Mus musculus | Kanamycin | PMID:26468009 | encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ | Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | interdomain A (Phe 119 to His 162) substituted by a flexible 20-amino-acid linker (GGS)3GS(GGS)3 | 2026-09-05 12:44:20 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.