Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 7 showing 121 ~ 140 out of 12,978 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_111044

http://www.addgene.org/111044

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111044 Copy   


  • RRID:Addgene_111041

http://www.addgene.org/111041

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27410476

Proper citation: RRID:Addgene_111041 Copy   


  • RRID:Addgene_111042

http://www.addgene.org/111042

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111042 Copy   


  • RRID:Addgene_111047

http://www.addgene.org/111047

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111047 Copy   


  • RRID:Addgene_111045

http://www.addgene.org/111045

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111045 Copy   


  • RRID:Addgene_111046

http://www.addgene.org/111046

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111046 Copy   


  • RRID:Addgene_111033

http://www.addgene.org/111033

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111033 Copy   


  • RRID:Addgene_111030

http://www.addgene.org/111030

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111030 Copy   


  • RRID:Addgene_111036

http://www.addgene.org/111036

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111036 Copy   


  • RRID:Addgene_111037

http://www.addgene.org/111037

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111037 Copy   


  • RRID:Addgene_111039

http://www.addgene.org/111039

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27410476

Proper citation: RRID:Addgene_111039 Copy   


  • RRID:Addgene_111141

http://www.addgene.org/111141

Species: Mus musculus
Genetic Insert: flag-lacZ25-119-DHFR-UbK48R-Val51-mIκBα
Vector Backbone Description: Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24550490

Proper citation: RRID:Addgene_111141 Copy   


http://www.addgene.org/111144

Species: Mus musculus
Genetic Insert: mouse Trex2 coding region
Vector Backbone Description: Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30912045

Proper citation: RRID:Addgene_111144 Copy   


  • RRID:Addgene_111139

http://www.addgene.org/111139

Species: Mus musculus
Genetic Insert: flag-lacZ25-119-DHFR-UbK48R-Glu51-mIκBα
Vector Backbone Description: Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24550490

Proper citation: RRID:Addgene_111139 Copy   


  • RRID:Addgene_111215

    This resource has 1+ mentions.

http://www.addgene.org/111215

Species: Mus musculus
Genetic Insert: AR
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:Unknown; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_111215 Copy   


  • RRID:Addgene_111150

    This resource has 1+ mentions.

http://www.addgene.org/111150

Species: Mus musculus
Genetic Insert: TFPnls-T2a-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_111150 Copy   


http://www.addgene.org/111151

Species: Mus musculus
Genetic Insert: TFPnls-T2a-mErt-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_111151 Copy   


  • RRID:Addgene_111269

    This resource has 1+ mentions.

http://www.addgene.org/111269

Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ

Proper citation: RRID:Addgene_111269 Copy   


  • RRID:Addgene_111274

    This resource has 1+ mentions.

http://www.addgene.org/111274

Species: Mus musculus
Genetic Insert: murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG

Proper citation: RRID:Addgene_111274 Copy   


  • RRID:Addgene_111272

    This resource has 1+ mentions.

http://www.addgene.org/111272

Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ

Proper citation: RRID:Addgene_111272 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X