Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: E. coli
Genetic Insert: Sigma32 I54N
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pBAD; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25051296
Proper citation: RRID:Addgene_59982 Copy
Species: E. coli
Genetic Insert: tnpA from pBam1
Vector Backbone Description: Backbone Marker:New England Biolabs; Backbone Size:6706; Vector Backbone:pTXB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25079858
Proper citation: RRID:Addgene_60240 Copy
Species: E. Coli
Genetic Insert: SspB nano
Vector Backbone Description: Backbone Marker:Qiagen; Backbone Size:5979; Vector Backbone:pQE-80L; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25535392
Comments: The SspB used in this construct contains two amino acid mutations that disrupt the natural dimerization of SspB. These mutations are Y11K and A15E (residue numbering from pdb code 1ou9). Here is the sequence around the mutated residues with the sites of mutation in parentheses: SSPKRP(K)LLR(E)YYDWLVDNS
Proper citation: RRID:Addgene_60409 Copy
Species: E. Coli
Genetic Insert: SspB micro
Vector Backbone Description: Backbone Marker:Qiagen; Backbone Size:5979; Vector Backbone:pQE-80L; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25535392
Comments: The SspB used in this construct contains two amino acid mutations that disrupt the natural dimerization of SspB. These mutations are Y11K and A15E (residue numbering from pdb code 1ou9). Here is the sequence around the mutated residues with the sites of mutation in parentheses: SSPKRP(K)LLR(E)YYDWLVDNS
Proper citation: RRID:Addgene_60410 Copy
Species: E. Coli
Genetic Insert: GalS-T
Vector Backbone Description: Backbone Marker:Expressys; Backbone Size:4040; Vector Backbone:pZS5; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25035932
Proper citation: RRID:Addgene_60753 Copy
Species: E. Coli
Genetic Insert: FruR-T
Vector Backbone Description: Backbone Marker:Expressys; Backbone Size:4040; Vector Backbone:pZS5; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25035932
Proper citation: RRID:Addgene_60752 Copy
Species: E. Coli
Genetic Insert: RbsR-T
Vector Backbone Description: Backbone Marker:Expressys; Backbone Size:4040; Vector Backbone:pZS5; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25035932
Proper citation: RRID:Addgene_60751 Copy
Species: E. Coli
Genetic Insert: TreR-T
Vector Backbone Description: Backbone Marker:Expressys; Backbone Size:4040; Vector Backbone:pZS5; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25035932
Proper citation: RRID:Addgene_60754 Copy
Species: E. coli
Genetic Insert: BirA
Vector Backbone Description: Backbone Marker:Euroscarf; Backbone Size:6929; Vector Backbone:pVTU-260; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25805862
Proper citation: RRID:Addgene_63682 Copy
Species: E. coli
Genetic Insert: lacZ alpha
Vector Backbone Description: Vector Backbone:pEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_61971 Copy
Species: E. coli
Genetic Insert: MG1655-tMMR
Vector Backbone Description: Vector Backbone:genomic; Vector Types:; Bacterial Resistance:Tetracycline
Defining Citation: PMID:24500200
Comments: For detailed use and MAGE, see:
1. Nyerges, Á. et al. Conditional DNA repair mutants enable highly precise genome engineering. Nucl. Acids Res. 42, e62–e62 (2014).
2. Gallagher, R. R., Li, Z., Lewis, A. O. & Isaacs, F. J. Rapid editing and evolution of bacterial genomes using libraries of synthetic DNA. Nat. Protocols 9, 2301–2316 (2014).
3. Bonde, M. T., Anderson, M. V., Wallin, A. I. N., Wang, H. H. & Sommer, M. O. A. MODEST: a web-based design tool for oligonucleotide-mediated genome engineering and recombineering. Nucl. Acids Res. (2014). doi:10.1093/nar/gku428
Proper citation: RRID:Addgene_62392 Copy
Species: E. coli
Genetic Insert: OmpA
Vector Backbone Description: Backbone Marker:DNA2.0; Backbone Size:4000; Vector Backbone:pJexpress414; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26199411
Comments: AA sequence: MKKTAIAIAVALAGFATVAQAAPNDNTWYTGAKLGWSQYHDTGFI
NNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLG
YPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWT
NNIGDYPYDVPDYATRPDNGMLSLGVSYRFGCCPGCCHHHHHH
Proper citation: RRID:Addgene_62646 Copy
Species: E. coli
Genetic Insert: RhyB sRNA
Vector Backbone Description: Backbone Marker:Lim lab; Vector Backbone:unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21189298
Proper citation: RRID:Addgene_52997 Copy
Species: E. coli
Genetic Insert: RhyB sRNA
Vector Backbone Description: Backbone Marker:Lim lab; Vector Backbone:unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21189298
Proper citation: RRID:Addgene_52998 Copy
Species: E. coli
Genetic Insert: RhyB sRNA
Vector Backbone Description: Backbone Marker:Lim lab; Vector Backbone:unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21189298
Proper citation: RRID:Addgene_53009 Copy
Species: E. coli
Genetic Insert: Cre
Vector Backbone Description: Vector Backbone:pSH47; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25688547
Comments: This plasmid contains a Y191CL mutation in the MET15 gene that does not impact selection or plasmid function.
Proper citation: RRID:Addgene_60933 Copy
Species: E. coli
Genetic Insert: Cre
Vector Backbone Description: Vector Backbone:pSH47; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25688547
Proper citation: RRID:Addgene_60931 Copy
Species: E. coli
Genetic Insert: msd(wt)_dRT
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61454 Copy
Species: E. coli
Genetic Insert: SCRIBE_galK(OFF)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZA11; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61455 Copy
Species: E. coli
Genetic Insert: msd_lacZ(ON)
Vector Backbone Description: Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61456 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
