Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: E. coli
Genetic Insert: msd(wt)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61453 Copy
Species: E. coli
Genetic Insert: msd_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61447 Copy
Species: E. coli
Genetic Insert: SCRIBE_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61448 Copy
Species: E. coli
Genetic Insert: SCRIBE_galK(OFF)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61449 Copy
Species: E. coli
Genetic Insert: lacZ alpha
Vector Backbone Description: Vector Backbone:pEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_61971 Copy
Species: E. coli
Genetic Insert: MG1655-tMMR
Vector Backbone Description: Vector Backbone:genomic; Vector Types:; Bacterial Resistance:Tetracycline
Defining Citation: PMID:24500200
Comments: For detailed use and MAGE, see:
1. Nyerges, Á. et al. Conditional DNA repair mutants enable highly precise genome engineering. Nucl. Acids Res. 42, e62–e62 (2014).
2. Gallagher, R. R., Li, Z., Lewis, A. O. & Isaacs, F. J. Rapid editing and evolution of bacterial genomes using libraries of synthetic DNA. Nat. Protocols 9, 2301–2316 (2014).
3. Bonde, M. T., Anderson, M. V., Wallin, A. I. N., Wang, H. H. & Sommer, M. O. A. MODEST: a web-based design tool for oligonucleotide-mediated genome engineering and recombineering. Nucl. Acids Res. (2014). doi:10.1093/nar/gku428
Proper citation: RRID:Addgene_62392 Copy
Species: E. coli
Genetic Insert: OmpA
Vector Backbone Description: Backbone Marker:DNA2.0; Backbone Size:4000; Vector Backbone:pJexpress414; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26199411
Comments: AA sequence: MKKTAIAIAVALAGFATVAQAAPNDNTWYTGAKLGWSQYHDTGFI
NNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLG
YPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWT
NNIGDYPYDVPDYATRPDNGMLSLGVSYRFGCCPGCCHHHHHH
Proper citation: RRID:Addgene_62646 Copy
Species: E. coli
Genetic Insert: EcoDam
Vector Backbone Description: Backbone Marker:PMID 9733856 ; Vector Backbone:HIV-CS-CG; Vector Types:Mammalian Expression, Lentiviral, DamID; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17038565
Comments: This is the control vector for expression of V5-Dam only (the absolutely essential control experiment!).
Proper citation: RRID:Addgene_59210 Copy
Species: E. coli
Genetic Insert: KanR
Vector Backbone Description: Backbone Size:4361; Vector Backbone:pBR322; Vector Types:Synthetic Biology, Diatom Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25302562
Comments: Note: There are some small discrepancies between Addgene's quality control sequence and the assembled sequence from the depositor. They should not affect the function of the plasmid.
Proper citation: RRID:Addgene_56659 Copy
Species: E. coli
Genetic Insert: RhyB sRNA
Vector Backbone Description: Backbone Marker:Lim lab; Vector Backbone:unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21189298
Proper citation: RRID:Addgene_52997 Copy
Species: E. coli
Genetic Insert: RhyB sRNA
Vector Backbone Description: Backbone Marker:Lim lab; Vector Backbone:unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21189298
Proper citation: RRID:Addgene_52998 Copy
Species: E. coli
Genetic Insert: RhyB sRNA
Vector Backbone Description: Backbone Marker:Lim lab; Vector Backbone:unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21189298
Proper citation: RRID:Addgene_53009 Copy
Species: E. coli
Genetic Insert: RNAP alpha NTD (aa 1-248) fused to E. coli sigma 70 (aa 528-613)
Vector Backbone Description: Vector Backbone:pBR322; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9121589
Comments: This plasmid is used in conjuction with the other Ann Hochschild Bacterial 2-hybrid system plasmids (Addgene plasmids 53730, 53731, 53732, 53733, and 53734) and must be used in the reporter strain, FW102 OL2–62 (Addgene item 53735). Please see the associated article for links to all of these plasmids:
http://www.addgene.org/browse/article/8393/
The following articles can provide more information on using the bacterial 2-hybrid system:
Dove, et al. 1997 PMID 9121589
Dove and Hochschild 1998 PMID 9499408
Deaconescu, et al. 2006 PMID 16469698
Deighan, et al. 2008 PMID 18832144
Kuznedelov, et al. 2002 PMID 11823642
Proper citation: RRID:Addgene_53732 Copy
Species: E. coli
Genetic Insert: Recoded E. coli genome with all instances of the UAG codon removed, but wild type UAG termination function is not changed
Vector Backbone Description: Vector Backbone:E. coli genome; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24136966
Comments: E. coli MG1655 delta(ybhB-bioAB)::[lcI857 N(cro-ea59)::tetR-bla] Delta mutS::zeoR; all 321 UAG codons changed to UAA
This strain is mutS-, which causes a spontaneous mutation frequency of ~2E-8. This strain is auxotrophic for d-biotin.
Sequence is similar to C321.DA (NCBI accession # NCBI CP006698), except that RF1 is not deleted.
Proper citation: RRID:Addgene_48999 Copy
Species: E. coli
Genetic Insert: FtsZ-mEos2
Vector Backbone Description: Backbone Marker:NBRP-E.coli at NIG; Backbone Size:4500; Vector Backbone:pCA24N; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:23859153
Proper citation: RRID:Addgene_49764 Copy
Species: E. coli
Genetic Insert: 'tesA
Vector Backbone Description: Backbone Size:0; Vector Backbone:p15a; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:20111002
Comments: EJ Steen et al. 2009 Nature 10.1038/nature08721
Proper citation: RRID:Addgene_24636 Copy
Species: E. coli
Genetic Insert: LacI
Vector Backbone Description: Vector Backbone:pSKunk-BLA; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:35657952
Proper citation: RRID:Addgene_190245 Copy
Species: E. coli
Genetic Insert: LacI
Vector Backbone Description: Vector Backbone:pSKunk-BLA; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:35657952
Proper citation: RRID:Addgene_190242 Copy
Species: E. coli
Genetic Insert: LacI
Vector Backbone Description: Vector Backbone:pSKunk-BLA; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:35657952
Proper citation: RRID:Addgene_190244 Copy
Species: E. coli
Genetic Insert: Retron Eco1 ncRNA v35 (long a1/a2, barcode 6 [CAG-CTG])
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:3829; Vector Backbone:pRSFDuet-1; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35896746
Comments: P35Q mutation in Cas2 insert does not affect plasmid function.
Please visit https://doi.org/10.1101/2021.08.11.455990 for bioRxiv preprint.
Proper citation: RRID:Addgene_187215 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
