Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: RNAi against human Protection of Telomeres 1
Vector Backbone Description: Backbone Size:3200; Vector Backbone:PSUPER; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15620654
Comments: Target sequence is: TACCT CGCAC TTCAA GCAA.
Proper citation: RRID:Addgene_11133 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: PRP40
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET21b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24231520
Proper citation: RRID:Addgene_111287 Copy
Species: Homo sapiens
Genetic Insert: c-myc, HRas
Vector Backbone Description: Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16267004
Comments: Contains mouse c-myc and human Hras. This plasmid was generated by cloning c-MycT58A cDNA with flanking BamHI-EcoRI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site H-RasG12V cDNA in which HindIII/ClaI sites were again added by PCR.
Proper citation: RRID:Addgene_11130 Copy
Species: Mus musculus
Genetic Insert: murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG
Proper citation: RRID:Addgene_111274 Copy
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111272 Copy
Species: Synthetic
Genetic Insert: ChETA-mRuby2
Vector Backbone Description: Backbone Size:4116; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392
Proper citation: RRID:Addgene_111389 Copy
Vector Backbone Description: Backbone Size:3154; Vector Backbone:pScaf; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30984875
Comments: Preprint available at https://www.biorxiv.org/content/early/2018/04/27/309682
Proper citation: RRID:Addgene_111401 Copy
Genetic Insert: pScaf-7560.1
Vector Backbone Description: Backbone Size:3154; Vector Backbone:pScaf; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30984875
Comments: Preprint available at https://www.biorxiv.org/content/early/2018/04/27/309682
Proper citation: RRID:Addgene_111406 Copy
Species: Homo sapiens
Genetic Insert: potassium voltage-gated channel subfamily KQT member 1 isoform 1 [Homo sapiens]
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29429937
Proper citation: RRID:Addgene_111452 Copy
Species: Synthetic
Genetic Insert: CaCas9/sgScADE2/stop-codon repair
Vector Backbone Description: Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29695624
Proper citation: RRID:Addgene_111444 Copy
Species: Mus musculus
Genetic Insert: mCAR
Vector Backbone Description: Backbone Size:4836; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392
Proper citation: RRID:Addgene_111393 Copy
Species: Homo sapiens
Genetic Insert: hCAR
Vector Backbone Description: Backbone Size:4117; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392
Proper citation: RRID:Addgene_111397 Copy
Species: Synthetic
Genetic Insert: CaCas9/sgRNA-BsmBI stuffer
Vector Backbone Description: Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29695624
Proper citation: RRID:Addgene_111436 Copy
Species: Synthetic
Genetic Insert: CaCas9/sgRNA-BsmBI stuffer
Vector Backbone Description: Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29695624
Proper citation: RRID:Addgene_111435 Copy
Species: Synthetic
Genetic Insert: GCaMP6m-XC
Vector Backbone Description: Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29666364
Proper citation: RRID:Addgene_111543 Copy
Species: Drosophila melanogaster
Genetic Insert: ChrimsonR_mCherry_trafficked
Vector Backbone Description: Vector Backbone:10XUAS IVS sv40; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24509633
Proper citation: RRID:Addgene_111547 Copy
Species: Xenopus laevis
Genetic Insert: calmodulin [Xenopus laevis]
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pIRES2-eGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29429937
Proper citation: RRID:Addgene_111499 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: HSP82
Vector Backbone Description: Backbone Marker:ATCC (#77189); Backbone Size:4453; Vector Backbone:pRS303; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9990037
Proper citation: RRID:Addgene_1115 Copy
Genetic Insert: cyan pre-eGRASP(p30)
Vector Backbone Description: Backbone Size:5293; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29700265
Proper citation: RRID:Addgene_111583 Copy
Species: Mus musculus
Genetic Insert: Cabp5 promoter
Vector Backbone Description: Backbone Size:3084; Vector Backbone:pCAGEN; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:14603031
Comments: The Cabp5 promoter is specific for bipolar cells in the retina
Proper citation: RRID:Addgene_11157 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
