Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: BAF47
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pDONR223; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30860482
Proper citation: RRID:Addgene_111181 Copy
Genetic Insert: Cre recombinase
Vector Backbone Description: Vector Backbone:pBAD22; Vector Types:Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:15568020
Comments: The protocol for preparation of electro-competent cells of DH10MultiBacCre,which carry the plasmid of pBADZ HisCre and enable the production of Cre recombinase, is described in Fitzgerald et al. (2006).
http://www.nature.com/articles/nmeth983
Proper citation: RRID:Addgene_111187 Copy
Species: Homo sapiens
Genetic Insert: BAF47
Vector Backbone Description: Backbone Marker:Broad Institute; Backbone Size:9354; Vector Backbone:pLXI_TRC401; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30860482
Proper citation: RRID:Addgene_111185 Copy
Species: Homo sapiens
Genetic Insert: miR-E (miR-30 variant)
Vector Backbone Description: Vector Backbone:pRRL; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24332856
Proper citation: RRID:Addgene_111171 Copy
Species: Homo sapiens
Genetic Insert: miR-E (miR-30 variant)
Vector Backbone Description: Vector Backbone:pRRL; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24332856
Proper citation: RRID:Addgene_111176 Copy
Species: Mus musculus
Genetic Insert: AR
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:Unknown; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_111215 Copy
Species: Homo sapiens
Genetic Insert: miR-E (miR-30 variant)
Vector Backbone Description: Vector Backbone:pQCXIX; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24332856
Proper citation: RRID:Addgene_111165 Copy
Species: Homo sapiens
Genetic Insert: miR-E (miR-30 variant)
Vector Backbone Description: Vector Backbone:pMSCV; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24332856
Proper citation: RRID:Addgene_111163 Copy
Vector Backbone Description: Vector Backbone:pQCXIX; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24332856
Proper citation: RRID:Addgene_111168 Copy
Species: Homo sapiens
Genetic Insert: miR-E (miR-30 variant)
Vector Backbone Description: Vector Backbone:pQCXIX; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24332856
Proper citation: RRID:Addgene_111169 Copy
Species: Homo sapiens
Genetic Insert: TNFRSF1A
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:Unknown; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_111209 Copy
Species: Mus musculus
Genetic Insert: TFPnls-T2a-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_111150 Copy
Species: Mus musculus
Genetic Insert: TFPnls-T2a-mErt-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_111151 Copy
Species: Xenopus laevis
Genetic Insert: TFPnls-T2a-mErt-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_111152 Copy
Species: Homo sapiens
Genetic Insert: hShh
Vector Backbone Description: Vector Backbone:pOEM1; Vector Types:Mammalian Expression, Insect Expression, Baculoviral rescue shuttle vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27120163
Proper citation: RRID:Addgene_111156 Copy
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111269 Copy
Species: Homo sapiens
Genetic Insert: hTERT, p53 dominant negative
Vector Backbone Description: Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16267004
Comments: This plasmid was generated by cloning FLAG-hTERT cDNA with flanking EcoRI-SalI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site p53DD cDNA in which HindIII/ClaI sites were again added by PCR.
Proper citation: RRID:Addgene_11128 Copy
Species: Synthetic
Genetic Insert: E2-Crimson
Vector Backbone Description: Backbone Marker:Dieter Haas; obtained from Culture Collection of Switzerland; Vector Backbone:pME6031; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline
Defining Citation: PMID:29449848
Proper citation: RRID:Addgene_111252 Copy
Species: Homo sapiens
Genetic Insert: Cyclin D1, Cyclin Dependent Kinase 4
Vector Backbone Description: Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16267004
Comments: This plasmid was generated by cloning cyclinD1 cDNA with flanking EcoRI-SalI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site CDK4R24C cDNA in which HindIII/ClaI sites were again added by PCR.
Proper citation: RRID:Addgene_11129 Copy
Species: Homo sapiens
Genetic Insert: human CLYBL
Vector Backbone Description: Backbone Size:7500; Vector Backbone:pLys1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29056341
Proper citation: RRID:Addgene_111290 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
