Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pDONR SMARCB1 var 2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111181 | BAF47 | Homo sapiens | Spectinomycin | PMID:30860482 | Backbone Marker:Invitrogen; Vector Backbone:pDONR223; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin | 2026-09-05 12:44:19 | 1 | ||
|
pBADZ-HisCre Resource Report Resource Website 1+ mentions |
RRID:Addgene_111187 | Cre recombinase | Bleocin (Zeocin) | PMID:15568020 | The protocol for preparation of electro-competent cells of DH10MultiBacCre,which carry the plasmid of pBADZ HisCre and enable the production of Cre recombinase, is described in Fitzgerald et al. (2006). http://www.nature.com/articles/nmeth983 | Vector Backbone:pBAD22; Vector Types:Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-09-05 12:44:19 | 1 | ||
|
pLXI_TRC403 SMARCB1 var 2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111185 | BAF47 | Homo sapiens | Ampicillin | PMID:30860482 | Backbone Marker:Broad Institute; Backbone Size:9354; Vector Backbone:pLXI_TRC401; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:19 | 1 | ||
|
SGEN Resource Report Resource Website 1+ mentions |
RRID:Addgene_111171 | miR-E (miR-30 variant) | Homo sapiens | Ampicillin | PMID:24332856 | Vector Backbone:pRRL; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | WT | 2026-09-05 12:44:19 | 7 | |
|
LT3REVIR Resource Report Resource Website 1+ mentions |
RRID:Addgene_111176 | miR-E (miR-30 variant) | Homo sapiens | Ampicillin | PMID:24332856 | Vector Backbone:pRRL; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | WT | 2026-09-05 12:44:19 | 3 | |
|
EGFP-AR Resource Report Resource Website 1+ mentions |
RRID:Addgene_111215 | AR | Mus musculus | Kanamycin | Backbone Marker:Clontech; Vector Backbone:Unknown; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-09-05 12:44:19 | 1 | |||
|
RT3GEN Resource Report Resource Website 1+ mentions |
RRID:Addgene_111165 | miR-E (miR-30 variant) | Homo sapiens | Ampicillin | PMID:24332856 | Vector Backbone:pQCXIX; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | WT | 2026-09-05 12:44:19 | 1 | |
|
LENC Resource Report Resource Website 1+ mentions |
RRID:Addgene_111163 | miR-E (miR-30 variant) | Homo sapiens | Ampicillin | PMID:24332856 | Vector Backbone:pMSCV; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | WT | 2026-09-05 12:44:19 | 5 | |
|
RT3REVIR Resource Report Resource Website 1+ mentions |
RRID:Addgene_111168 | Ampicillin | PMID:24332856 | Vector Backbone:pQCXIX; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:19 | 1 | ||||
|
RT3GEPIR Resource Report Resource Website 1+ mentions |
RRID:Addgene_111169 | miR-E (miR-30 variant) | Homo sapiens | Ampicillin | PMID:24332856 | Vector Backbone:pQCXIX; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | WT | 2026-09-05 12:44:19 | 3 | |
|
TNFR1-YFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_111209 | TNFRSF1A | Homo sapiens | Kanamycin | Backbone Marker:Clontech; Vector Backbone:Unknown; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-09-05 12:44:19 | 1 | |||
|
Prrx1:TFPnls-T2a-Cre-Ert Resource Report Resource Website 1+ mentions |
RRID:Addgene_111150 | TFPnls-T2a-Cre-Ert | Mus musculus | Ampicillin | Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin | wt | 2026-09-05 12:44:19 | 1 | ||
|
Col1A2:TFPnls-T2a-mErt-Cre-Ert Resource Report Resource Website 1+ mentions |
RRID:Addgene_111151 | TFPnls-T2a-mErt-Cre-Ert | Mus musculus | Ampicillin | Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin | wt | 2026-09-05 12:44:19 | 1 | ||
|
Col2a1:TFPnls-mErt-Cre-Ert Resource Report Resource Website 1+ mentions |
RRID:Addgene_111152 | TFPnls-T2a-mErt-Cre-Ert | Xenopus laevis | Ampicillin | Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin | wt | 2026-09-05 12:44:19 | 1 | ||
|
pOEM1_pCMV:hShh-pPH:vsvged Resource Report Resource Website 1+ mentions |
RRID:Addgene_111156 | hShh | Homo sapiens | Ampicillin | PMID:27120163 | Vector Backbone:pOEM1; Vector Types:Mammalian Expression, Insect Expression, Baculoviral rescue shuttle vector; Bacterial Resistance:Ampicillin | wt | 2026-09-05 12:44:19 | 1 | |
|
pET-30a(+)-Syk-tSH2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111269 | murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form | Mus musculus | Kanamycin | PMID:26468009 | encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ | Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-09-05 12:44:20 | 1 | |
|
pbabe-hTERT+p53DD Resource Report Resource Website 1+ mentions |
RRID:Addgene_11128 | hTERT, p53 dominant negative | Homo sapiens | Ampicillin | PMID:16267004 | This plasmid was generated by cloning FLAG-hTERT cDNA with flanking EcoRI-SalI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site p53DD cDNA in which HindIII/ClaI sites were again added by PCR. | Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | p53 dominant negative (aa1-14; 303-390) | 2026-09-05 12:44:20 | 6 |
|
pSW002-Pc-E2-Crimson Resource Report Resource Website 1+ mentions |
RRID:Addgene_111252 | E2-Crimson | Synthetic | Tetracycline | PMID:29449848 | Backbone Marker:Dieter Haas; obtained from Culture Collection of Switzerland; Vector Backbone:pME6031; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline | 2026-09-05 12:44:20 | 2 | ||
|
pbabe-cyclinD1+CDK4R24C Resource Report Resource Website 1+ mentions |
RRID:Addgene_11129 | Cyclin D1, Cyclin Dependent Kinase 4 | Homo sapiens | Ampicillin | PMID:16267004 | This plasmid was generated by cloning cyclinD1 cDNA with flanking EcoRI-SalI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site CDK4R24C cDNA in which HindIII/ClaI sites were again added by PCR. | Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | CDK4 R24C | 2026-09-05 12:44:20 | 6 |
|
HsCLYBL-FLAG Resource Report Resource Website 1+ mentions |
RRID:Addgene_111290 | human CLYBL | Homo sapiens | Ampicillin | PMID:29056341 | Backbone Size:7500; Vector Backbone:pLys1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-09-05 12:44:20 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
