Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:synthetic (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

30,615 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pCDH-PGK-Nluc-P2A-copGFP-T2A-Puro
 
Resource Report
Resource Website 		RRID:Addgene_73040 Nluc-P2A-copGFP-T2A-Puro Synthetic Ampicillin Backbone Marker:Systembio; Backbone Size:6396; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin 2026-09-01 10:01:09 0
pCDH-EF1S-Nluc-P2A-copGFP-T2A-Puro
 
Resource Report
Resource Website 		RRID:Addgene_73032 Nluc-P2A-copGFP-T2A-Puro Synthetic Ampicillin Backbone Marker:Systembio; Backbone Size:6421; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin 2026-09-01 10:01:08 0
pCDH-EF1S-Nluc
 
Resource Report
Resource Website 		RRID:Addgene_73033 Nluc Synthetic Ampicillin Backbone Marker:Systembio; Backbone Size:6421; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin 2026-09-01 10:01:08 0
pCDH-CMV-Nluc-P2A-copGFP-T2A-Puro
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_73037 Nluc-P2A-copGFP-T2A-Puro Synthetic Ampicillin Backbone Marker:Systembio; Backbone Size:6227; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin 2026-09-01 10:01:08 8
pCDH-CMV-Nluc
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_73038 Nluc Synthetic Ampicillin Backbone Marker:Systembio; Backbone Size:6227; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin 2026-09-01 10:01:09 2
pBP-L1U1H09
 
Resource Report
Resource Website 		RRID:Addgene_73008 L1U1H09 terminator Synthetic Chloramphenicol PMID:27096716 Backbone Marker:iGEM; Backbone Size:2139; Vector Backbone:pSB1C3; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol CAT gene - C435G (nucleotide) - silent mutagenesis to remove BsmBI site 2026-09-01 10:01:08 0
pCDH-EF1-Nluc
 
Resource Report
Resource Website 		RRID:Addgene_73024 Nluc Synthetic Ampicillin Backbone Marker:Systembio; Backbone Size:7133; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-09-01 10:01:08 0
pTU2_2a
 
Resource Report
Resource Website 		RRID:Addgene_73010 Secondary module + Golden Gate pTU2a BsmBI destination site Synthetic Chloramphenicol PMID:27096716 Backbone Marker:iGEM; Backbone Size:3120; Vector Backbone:pSB1C3; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol CAT gene - C435G (nucleotide) - silent mutagenesis to remove BsmBI site 2026-09-01 10:01:08 0
pBS-TarHom-Tol2-FRT-GalK-cryaa-CFP
 
Resource Report
Resource Website 		RRID:Addgene_73200 CFP Synthetic Ampicillin PMID:26818072 Vector Backbone:pBluescript; Vector Types:; Bacterial Resistance:Ampicillin 2026-09-01 10:01:11 0
pBS-TarHom-Tol2-TetR-cryaa-YFP
 
Resource Report
Resource Website 		RRID:Addgene_73202 YFP Synthetic Ampicillin PMID:26818072 Vector Backbone:pBluescript; Vector Types:; Bacterial Resistance:Ampicillin 2026-09-01 10:01:11 0
pBS-TarHom-Tol2-FRT-GalK-cryaa-YFP
 
Resource Report
Resource Website 		RRID:Addgene_73198 YFP Synthetic Ampicillin PMID:26818072 Vector Backbone:pBluescript; Vector Types:; Bacterial Resistance:Ampicillin 2026-09-01 10:01:11 0
CAG sHRPa-FRB-pre mGRASP
 
Resource Report
Resource Website 		RRID:Addgene_73145 sHRPa-FRB-pre mGRASP Synthetic Ampicillin PMID:27240195 sHRPa is the large split HRP fragment. It consists of amino acids 1-213 of horseradish peroxidase (HRP) with the following 4 mutations: T21I, P78S, R93G, N175S. The insert contains the following features: EcoRI-β integrin ss-AgeI-sHRPa-10 aa linker-XhoI-FRB-MfeI-flag-CD4-2(25-242 aa)-NRX1β(414-468 aa)-NotI-stop-HindIII CAG promoter 10 aa linker: KGSGSTSGSG FRB: we used a 94 aa sequence that matches residues 5-98 of chain A in PDB 1AUE Nematode β integrin ss: MPPSTSLLLLAALLPFALPASDWKTGEVTAS This construct is identical to the previously reported “pre-mGRASP” (Addgene ID 34910) except AgeI and NotI restriction sites are added here, and the 5 aa linker here is shorter than the previously reported 10 aa linker. Backbone Size:4247; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 10:01:10 0
pDisplay sHRPa-KDEL
 
Resource Report
Resource Website 		RRID:Addgene_73149 sHRPa-KDEL Synthetic Ampicillin PMID:27240195 sHRPa is the large split HRP fragment. It consists of amino acids 1-213 of horseradish peroxidase (HRP) with the following 4 mutations: T21I, P78S, R93G, N175S. The insert contains the following features: EcoRI-Ig k-chain ss-BglII-FLAG tag-sHRPa-3aa linker-KDEL-Stop-AscI Ig k-chain signal sequence: METDTLLLWVLLLWVPGSTGD 3 aa linker: GSG FLAG tag: DYKDDDDK Backbone Size:5208; Vector Backbone:pDisplay; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 10:01:10 0
pAdx-CMV-YFP
 
Resource Report
Resource Website 		RRID:Addgene_73348 CMV-YFP Synthetic Ampicillin Backbone Marker:Clontech; Backbone Size:32705; Vector Backbone:pAdenoX; Vector Types:Adenoviral; Bacterial Resistance:Ampicillin 2026-09-01 10:01:13 0
pAdx-CMV-iCre-P2A-copGFP
 
Resource Report
Resource Website 		RRID:Addgene_73350 CMV-copGFP-T2A-iCre Synthetic Ampicillin Please note: although this plasmid is named pAdx-CMV-iCre-P2A-copGFP, the insert is ordered - CMV-copGFP-T2A-iCre Backbone Marker:Clontech; Backbone Size:32705; Vector Backbone:pAdenoX; Vector Types:Adenoviral; Bacterial Resistance:Ampicillin 2026-09-01 10:01:13 0
pAdx-CMV-iCre-P2A-tdTomato
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_73351 CMV-iCre-tdtomato Synthetic Ampicillin Backbone Marker:Clontech; Backbone Size:32705; Vector Backbone:pAdenoX; Vector Types:Adenoviral; Bacterial Resistance:Ampicillin 2026-09-01 10:01:13 1
pdCas9-M-4F2
 
Resource Report
Resource Website 		RRID:Addgene_73431 Repressor 4F2 (orthogonal T7-lac repressor) Synthetic Chloramphenicol PMID:27079979 Also encodes dCas9 and tracrRNA. Backbone Marker:Luciano Marraffini (Addgene plasmid # 46569); Backbone Size:9296; Vector Backbone:pdCas9; Vector Types:Bacterial Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-09-01 10:01:14 0
pdCas9-M-1B6
 
Resource Report
Resource Website 		RRID:Addgene_73430 Repressor 1B6 (orthogonal T7-lac repressor) Synthetic Chloramphenicol PMID:27079979 Also encodes dCas9 and tracrRNA. Backbone Marker:Luciano Marraffini (Addgene plasmid # 46569); Backbone Size:9296; Vector Backbone:pdCas9; Vector Types:Bacterial Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-09-01 10:01:14 0
pdCas9-M-1E4
 
Resource Report
Resource Website 		RRID:Addgene_73436 Repressor 1E4 (orthogonal T7-lac repressor) Synthetic Chloramphenicol PMID:27079979 Also encodes dCas9 and tracrRNA. Backbone Marker:Luciano Marraffini (Addgene plasmid # 46569); Backbone Size:9296; Vector Backbone:pdCas9; Vector Types:Bacterial Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-09-01 10:01:14 0
pdCas9-M-3A2
 
Resource Report
Resource Website 		RRID:Addgene_73435 Repressor 3A2 (orthogonal T7-lac repressor) Synthetic Chloramphenicol PMID:27079979 Also encodes dCas9 and tracrRNA. Backbone Marker:Luciano Marraffini (Addgene plasmid # 46569); Backbone Size:9296; Vector Backbone:pdCas9; Vector Types:Bacterial Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-09-01 10:01:14 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch