Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: Nluc-P2A-copGFP-T2A-Puro
Vector Backbone Description: Backbone Marker:Systembio; Backbone Size:6396; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_73040 Copy
Species: Synthetic
Genetic Insert: Nluc-P2A-copGFP-T2A-Puro
Vector Backbone Description: Backbone Marker:Systembio; Backbone Size:6421; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_73032 Copy
Species: Synthetic
Genetic Insert: Nluc
Vector Backbone Description: Backbone Marker:Systembio; Backbone Size:6421; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_73033 Copy
Species: Synthetic
Genetic Insert: Nluc-P2A-copGFP-T2A-Puro
Vector Backbone Description: Backbone Marker:Systembio; Backbone Size:6227; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_73037 Copy
Species: Synthetic
Genetic Insert: Nluc
Vector Backbone Description: Backbone Marker:Systembio; Backbone Size:6227; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_73038 Copy
Species: Synthetic
Genetic Insert: L1U1H09 terminator
Vector Backbone Description: Backbone Marker:iGEM; Backbone Size:2139; Vector Backbone:pSB1C3; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:27096716
Proper citation: RRID:Addgene_73008 Copy
Species: Synthetic
Genetic Insert: Nluc
Vector Backbone Description: Backbone Marker:Systembio; Backbone Size:7133; Vector Backbone:pCDH-CMV-MCS; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_73024 Copy
Species: Synthetic
Genetic Insert: Secondary module + Golden Gate pTU2a BsmBI destination site
Vector Backbone Description: Backbone Marker:iGEM; Backbone Size:3120; Vector Backbone:pSB1C3; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:27096716
Proper citation: RRID:Addgene_73010 Copy
Species: Synthetic
Genetic Insert: CFP
Vector Backbone Description: Vector Backbone:pBluescript; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26818072
Proper citation: RRID:Addgene_73200 Copy
Species: Synthetic
Genetic Insert: YFP
Vector Backbone Description: Vector Backbone:pBluescript; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26818072
Proper citation: RRID:Addgene_73202 Copy
Species: Synthetic
Genetic Insert: YFP
Vector Backbone Description: Vector Backbone:pBluescript; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26818072
Proper citation: RRID:Addgene_73198 Copy
Species: Synthetic
Genetic Insert: sHRPa-FRB-pre mGRASP
Vector Backbone Description: Backbone Size:4247; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27240195
Comments: sHRPa is the large split HRP fragment. It consists of amino acids 1-213 of horseradish peroxidase (HRP) with the following 4 mutations: T21I, P78S, R93G, N175S.
The insert contains the following features:
EcoRI-β integrin ss-AgeI-sHRPa-10 aa linker-XhoI-FRB-MfeI-flag-CD4-2(25-242 aa)-NRX1β(414-468 aa)-NotI-stop-HindIII
CAG promoter
10 aa linker: KGSGSTSGSG
FRB: we used a 94 aa sequence that matches residues 5-98 of chain A in PDB 1AUE
Nematode β integrin ss: MPPSTSLLLLAALLPFALPASDWKTGEVTAS
This construct is identical to the previously reported “pre-mGRASP” (Addgene ID 34910) except AgeI and NotI restriction sites are added here, and the 5 aa linker here is shorter than the previously reported 10 aa linker.
Proper citation: RRID:Addgene_73145 Copy
Species: Synthetic
Genetic Insert: sHRPa-KDEL
Vector Backbone Description: Backbone Size:5208; Vector Backbone:pDisplay; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27240195
Comments: sHRPa is the large split HRP fragment. It consists of amino acids 1-213 of horseradish peroxidase (HRP) with the following 4 mutations: T21I, P78S, R93G, N175S.
The insert contains the following features:
EcoRI-Ig k-chain ss-BglII-FLAG tag-sHRPa-3aa linker-KDEL-Stop-AscI
Ig k-chain signal sequence: METDTLLLWVLLLWVPGSTGD
3 aa linker: GSG
FLAG tag: DYKDDDDK
Proper citation: RRID:Addgene_73149 Copy
Species: Synthetic
Genetic Insert: CMV-YFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:32705; Vector Backbone:pAdenoX; Vector Types:Adenoviral; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_73348 Copy
Species: Synthetic
Genetic Insert: CMV-copGFP-T2A-iCre
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:32705; Vector Backbone:pAdenoX; Vector Types:Adenoviral; Bacterial Resistance:Ampicillin
Comments: Please note: although this plasmid is named pAdx-CMV-iCre-P2A-copGFP, the insert is ordered - CMV-copGFP-T2A-iCre
Proper citation: RRID:Addgene_73350 Copy
Species: Synthetic
Genetic Insert: CMV-iCre-tdtomato
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:32705; Vector Backbone:pAdenoX; Vector Types:Adenoviral; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_73351 Copy
Species: Synthetic
Genetic Insert: Repressor 4F2 (orthogonal T7-lac repressor)
Vector Backbone Description: Backbone Marker:Luciano Marraffini (Addgene plasmid # 46569); Backbone Size:9296; Vector Backbone:pdCas9; Vector Types:Bacterial Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:27079979
Comments: Also encodes dCas9 and tracrRNA.
Proper citation: RRID:Addgene_73431 Copy
Species: Synthetic
Genetic Insert: Repressor 1B6 (orthogonal T7-lac repressor)
Vector Backbone Description: Backbone Marker:Luciano Marraffini (Addgene plasmid # 46569); Backbone Size:9296; Vector Backbone:pdCas9; Vector Types:Bacterial Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:27079979
Comments: Also encodes dCas9 and tracrRNA.
Proper citation: RRID:Addgene_73430 Copy
Species: Synthetic
Genetic Insert: Repressor 1E4 (orthogonal T7-lac repressor)
Vector Backbone Description: Backbone Marker:Luciano Marraffini (Addgene plasmid # 46569); Backbone Size:9296; Vector Backbone:pdCas9; Vector Types:Bacterial Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:27079979
Comments: Also encodes dCas9 and tracrRNA.
Proper citation: RRID:Addgene_73436 Copy
Species: Synthetic
Genetic Insert: Repressor 3A2 (orthogonal T7-lac repressor)
Vector Backbone Description: Backbone Marker:Luciano Marraffini (Addgene plasmid # 46569); Backbone Size:9296; Vector Backbone:pdCas9; Vector Types:Bacterial Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:27079979
Comments: Also encodes dCas9 and tracrRNA.
Proper citation: RRID:Addgene_73435 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
