Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Discosoma sp.
Genetic Insert: tdTomato
Vector Backbone Description: Backbone Marker:Stratagene; Vector Backbone:pBluescript SK(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553
Proper citation: RRID:Addgene_104105 Copy
Species: Aequorea victoria
Genetic Insert: EYFP
Vector Backbone Description: Backbone Marker:Stratagene; Vector Backbone:pBluescript SK(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553
Proper citation: RRID:Addgene_104104 Copy
Species: Discosoma sp.
Genetic Insert: tdTomato
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553
Proper citation: RRID:Addgene_104112 Copy
Species: Aequorea victoria
Genetic Insert: EYFP
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553
Proper citation: RRID:Addgene_104111 Copy
Species: Synthetic
Genetic Insert: CheRiff-CFP
Vector Backbone Description: Backbone Size:9000; Vector Backbone:fCAG-FLEX; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30275587
Proper citation: RRID:Addgene_104114 Copy
Species: Aequorea victoria
Genetic Insert: mTurquoise2
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553
Proper citation: RRID:Addgene_104110 Copy
Genetic Insert: TVA-mCherry fusion protein
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:AAV, Adeno Associated Viral Vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28689641
Proper citation: RRID:Addgene_104330 Copy
Species: Other
Genetic Insert: mito-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26648024
Proper citation: RRID:Addgene_104309 Copy
Species: Homo sapiens
Genetic Insert: ARHGAP12 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTRD
Proper citation: RRID:Addgene_104274 Copy
Species: Homo sapiens
Genetic Insert: Human integrin b2 with tension sensor
Vector Backbone Description: Backbone Size:5596; Vector Backbone:pcDNA3.1/Hygro(-); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27721490
Proper citation: RRID:Addgene_104355 Copy
https://dgrc.bio.indiana.edu/stock/1660994
Species: Drosophila melanogaster
Comments: BDGP Gold cDNAs
Proper citation: RRID:DGRC_1660994 Copy
Species: Homo sapiens
Genetic Insert: ALG14
Vector Backbone Description: Backbone Marker:Eric-Paul Bennett (Addgene plasmid # 68369); Backbone Size:2376; Vector Backbone:EPB104; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29315387
Proper citation: RRID:Addgene_106867 Copy
Species: Homo sapiens
Genetic Insert: human Importin beta-1 (KPNB1)
Vector Backbone Description: Backbone Marker: Clontech ; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:15572412
Comments: This plasmid was created by Antonella Palena in the Lavia Lab.
Proper citation: RRID:Addgene_106941 Copy
Species: Mus musculus
Genetic Insert: tristetraprolin
Vector Backbone Description: Backbone Marker:Thermo Scientific; Vector Backbone:pTRIPZ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29246442
Comments: Please note- Addgene's quality control found one “g” nucleotide missing from the insert sequence. The depositor noted this "g" should make no difference to the function of plasmid, since it is located within an intron and will be spliced out.
Proper citation: RRID:Addgene_107000 Copy
Species: Homo sapiens
Genetic Insert: UGGT2
Vector Backbone Description: Backbone Marker:Eric-Paul Bennett (Addgene plasmid # 68369); Backbone Size:2376; Vector Backbone:EPB104; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29315387
Proper citation: RRID:Addgene_106834 Copy
Species: Homo sapiens
Genetic Insert: UGGT1
Vector Backbone Description: Backbone Marker:Eric-Paul Bennett (Addgene plasmid # 68369); Backbone Size:2376; Vector Backbone:EPB104; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29315387
Proper citation: RRID:Addgene_106833 Copy
Species: Homo sapiens
Genetic Insert: hTERT shRNA
Vector Backbone Description: Backbone Size:6700; Vector Backbone:pMKO.1; Vector Types:Mammalian Expression, Retroviral, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15928077
Comments: hTERT 3114-3134 (coding region): Forward TTTCATCAGCAAGTTTGGAttcaagagaTCCAAACTTGCTGATGAAAtttttg ; Reverse aattcaaaaaTTTCATCAGCAAGTTTGGAtctcttgaaTCCAAACTTGCTGATGAAA .
Proper citation: RRID:Addgene_10688 Copy
Genetic Insert: FKBP-EGFP-HOTag3
Vector Backbone Description: Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29307513
Proper citation: RRID:Addgene_106924 Copy
Species: Homo sapiens
Genetic Insert: FKHR deltaDB
Vector Backbone Description: Backbone Size:5200; Vector Backbone:pBabe puro L; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_10695 Copy
Species: Homo sapiens
Genetic Insert: FKHR deltaDB
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_10694 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
