Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Mentions:yes (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

32,424 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pBS-TRE-tdTomato-WPRE
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104105 tdTomato Discosoma sp. Ampicillin PMID:30454553 Backbone Marker:Stratagene; Vector Backbone:pBluescript SK(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:16 3
pBS-TRE-EYFP-WPRE
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104104 EYFP Aequorea victoria Ampicillin PMID:30454553 Backbone Marker:Stratagene; Vector Backbone:pBluescript SK(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:16 1
pAAV-TRE-tdTomato-WPRE
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104112 tdTomato Discosoma sp. Ampicillin PMID:30454553 Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin 2026-09-01 09:10:17 4
pAAV-TRE-EYFP-WPRE
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104111 EYFP Aequorea victoria Ampicillin PMID:30454553 Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin 2026-09-01 09:10:17 1
LZF43: Cre-on CAG-CheRiff-CFP (DIO)
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104114 CheRiff-CFP Synthetic Ampicillin PMID:30275587 Backbone Size:9000; Vector Backbone:fCAG-FLEX; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-09-01 09:10:17 1
pAAV-TRE-mTurquoise2-WPRE
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104110 mTurquoise2 Aequorea victoria Ampicillin PMID:30454553 Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin 2026-09-01 09:10:17 2
pAAV-CMV-TVAmCherry-2A-oG
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104330 TVA-mCherry fusion protein Ampicillin PMID:28689641 Vector Backbone:pAAV; Vector Types:AAV, Adeno Associated Viral Vector; Bacterial Resistance:Ampicillin 2026-09-01 09:10:19 1
mito-mGarnet
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104309 mito-mGarnet Other Ampicillin PMID:26648024 Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:19 2
pHH0103 ARHGAP12 WW domain #1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104274 ARHGAP12 WW domain #1 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTRD Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:19 2
pcDNA3.1/Hygro(-)-B2-cT
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104355 Human integrin b2 with tension sensor Homo sapiens Ampicillin PMID:27721490 Backbone Size:5596; Vector Backbone:pcDNA3.1/Hygro(-); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:20 1
FI19713
 
Resource Report
Resource Website
1+ mentions 		RRID:DGRC_1660994 Drosophila melanogaster Ampicillin BDGP Gold cDNAs 2026-08-29 06:12:24 1
gh268
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_106867 ALG14 Homo sapiens Ampicillin PMID:29315387 Backbone Marker:Eric-Paul Bennett (Addgene plasmid # 68369); Backbone Size:2376; Vector Backbone:EPB104; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:57 1
pEGFP-N1 Full length Importin beta
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_106941 human Importin beta-1 (KPNB1) Homo sapiens Kanamycin PMID:15572412 This plasmid was created by Antonella Palena in the Lavia Lab. Backbone Marker: Clontech ; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:10:58 4
pTRIPZ Myc2-mouse TTP WT
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_107000 tristetraprolin Mus musculus Ampicillin PMID:29246442 Please note- Addgene's quality control found one “g” nucleotide missing from the insert sequence. The depositor noted this "g" should make no difference to the function of plasmid, since it is located within an intron and will be spliced out. Backbone Marker:Thermo Scientific; Vector Backbone:pTRIPZ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:58 1
gh173
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_106834 UGGT2 Homo sapiens Ampicillin PMID:29315387 Backbone Marker:Eric-Paul Bennett (Addgene plasmid # 68369); Backbone Size:2376; Vector Backbone:EPB104; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:56 1
gh172
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_106833 UGGT1 Homo sapiens Ampicillin PMID:29315387 Backbone Marker:Eric-Paul Bennett (Addgene plasmid # 68369); Backbone Size:2376; Vector Backbone:EPB104; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:56 1
pMKO.1 puro hTERT shRNA
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_10688 hTERT shRNA Homo sapiens Ampicillin PMID:15928077 hTERT 3114-3134 (coding region): Forward TTTCATCAGCAAGTTTGGAttcaagagaTCCAAACTTGCTGATGAAAtttttg ; Reverse aattcaaaaaTTTCATCAGCAAGTTTGGAtctcttgaaTCCAAACTTGCTGATGAAA . Backbone Size:6700; Vector Backbone:pMKO.1; Vector Types:Mammalian Expression, Retroviral, RNAi; Bacterial Resistance:Ampicillin 2026-09-01 09:10:57 6
pcDNA3-FKBP-EGFP-HOTag3
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_106924 FKBP-EGFP-HOTag3 Ampicillin PMID:29307513 Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:57 3
1355 pBabe puroL FKHR deltaDB
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_10695 FKHR deltaDB Homo sapiens Ampicillin Backbone Size:5200; Vector Backbone:pBabe puro L; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin deletion of amino acids 208-220 2026-09-01 09:10:58 1
1354 pcDNA3 flag FKHR deltaDB
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_10694 FKHR deltaDB Homo sapiens Ampicillin Backbone Marker:Invitrogen; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin deletion of amino acids 208-220 2026-09-01 09:10:58 4

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch