Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Mentions:yes (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

32,424 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pEB1-2ndVal mGFPmut2
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104033 2ndVal mGFPmut2 Synthetic Kanamycin PMID:29320486 This is a version of mGFPmut2 with a valine inserted in the second position. Please see "Notes On Plasmids In This Collection" document for further details and references. Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin mGFPmut2 with valine inserted in 2nd position 2026-09-01 09:10:15 1
pEB1-mYPet
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_103988 mYPet Synthetic Kanamycin PMID:29320486 This FP derives from wtGFP. In this plasmid, the FP is coded with the original wtGFP nucleotide coding sequence except where mutations specific to the FP occur (see map). Please see "Notes On Plasmids In This Collection" document for further details and references. Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin Mutations relative to wild-type GFP (F46L, I47L, F64L, S65G, S72A, M153T, V163A, S175G, T203Y, A206K, S208F, V224L, H231E, D234N) 2026-09-01 09:10:14 1
pEB1-mVenus JBC
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_103987 mVenus JBC Synthetic Kanamycin PMID:29320486 This FP derives from wtGFP. In this plasmid, the FP is coded with the original wtGFP nucleotide coding sequence except where mutations specific to the FP occur (see map). Please see "Notes On Plasmids In This Collection" document for further details and references. Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin Mutations relative to wild-type GFP (F46L, F64L, S65G, V68L, S72A, M153T, V163A, S175G, T203Y, A206K) 2026-09-01 09:10:14 1
pEB1-moxGFP
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_103984 moxGFP Synthetic Kanamycin PMID:29320486 This FP derives from wtGFP. In this plasmid, the FP is coded with the original wtGFP nucleotide coding sequence except where mutations specific to the FP occur (see map). Please see "Notes On Plasmids In This Collection" document for further details and references. Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin Mutations relative to wild-type GFP (S30R, Y39N, C48S, F64L, S65T, C70S, F99S, N105T, Y145F, M153T, V163A, I171V, A206K) 2026-09-01 09:10:14 1
pEB2-E2-Crimson
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104010 E2-Crimson Synthetic Kanamycin PMID:29320486 This FP derives from DsRed. Please see "Notes On Plasmids In This Collection" document for further details and references. Backbone Size:3224; Vector Backbone:pEB2; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin Mutations relative to DsRed (R2D, S4T, K5E, E10P, R17H, T21S, E32V, R36K, H41T, N42Q, V44A, K47Q, Q66F, V71A, V73I, K83L, L85Q, C117T, F118L, K121H, M141L, A145P, L150N, I161N, K163M, D169G, V175C, Q188K, Y193H, S197Y, I210V, T217A, G219A, L225Q) 2026-09-01 09:10:15 1
pEB1-comCerulean3
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104017 comCerulean3 Synthetic Kanamycin PMID:29320486 This is a codon optimized version of mCerulean3. Please see "Notes On Plasmids In This Collection" document for further details and references. Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin Same protein sequence as mCerulean3 (codon optimized nucleotide sequence) 2026-09-01 09:10:15 1
p3s-eCas9-1.1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104172 eCas9-1.1 Other Ampicillin PMID:29141659 Vector Backbone:p3s; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin K848A, K1003A, R1060A 2026-09-01 09:10:17 1
pTP1183
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104163 Anti-rabbit IgG Fc specific nanobody TP897 (1xCysteine) Vicugna pacos Kanamycin PMID:29263082 Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 5
pTP1174
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104162 Anti-mouse kappa chain specific nanobody TP1170 (1xCysteine) Vicugna pacos Kanamycin PMID:29263082 Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 2
pHH0103 NEDD4 WW domain #1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104208 NEDD4 WW domain #1 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDN Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:18 1
LentiRCas9-CUG
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104183 U6-CUGsgRNA, EFS-PIN-dCas9 Ampicillin PMID:28803727 Vector Backbone:LentiCRISPR v2; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin 2026-09-01 09:10:17 1
pHH0103 WWP2 WW domain #4
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104215 WWP2 WW domain #4 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:18 1
pHH0103 WWP2 WW domain #3
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104214 WWP2 WW domain #3 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMI Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:18 1
pTP1112
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104158 Anti-mouse IgG1 Fc specific nanobody TP1107 (1xCysteine) Vicugna pacos Kanamycin PMID:29263082 Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 5
pTP943
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104157 Anti-mouse IgG1 Fab specific nanobody TP886 Vicugna pacos Kanamycin PMID:29263082 Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 3
pcDNA3.1-HA-ARHGAP29
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104154 ARHGAP29 Homo sapiens Ampicillin PMID:28538170 Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:17 3
pDG02583
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104129 NEDD8-specific protease 1 (NEDP1) Brachypodium distachyon Kanamycin PMID:29263082 Supporting reference: A new set of highly efficient, tag-cleaving proteases for purifying recombinant proteins. J Chromatogr A. 2014 Apr 11;1337:95-105. doi: 10.1016/j.chroma.2014.02.029 Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 7
pSF4 TetCMV intron Renilla-STOP 24xPP7 1xfirefly-siRNA 24xMS2 SV40 CTE polyA
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104097 Renilla luciferase Renilla reniformis Ampicillin PMID:29056324 Vector Backbone:pSF4; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:16 2
phage UbiC NLS HA stdMCP Halo
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104098 stdMCP-Halo Synthetic Ampicillin PMID:29056324 Vector Backbone:pHAGE-UbiC; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-09-01 09:10:16 2
pTECH-chAcK3RS(IPYE)
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104069 Plpp chAcK3RS(IPYE); PproK pyl Synthetic Chloramphenicol PMID:29035361 Backbone Marker:Liu Lab; Vector Backbone:p15A; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol Contains activating mutations V31I, T56P, H62Y, A100E (IPYE) in the chAcK3RS gene 2026-09-01 09:10:16 2

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join NIH's “It's About Time: Temporal Reasoning in Biomedical Knowledge Graphs Challenge”

dkNET community events and announcements in September, 2026

dkNET community events and announcements in August, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch