Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Validation:information available (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Target Antigen

Sort Ascending

Sort Descending

 Target Organism

Sort Ascending

Sort Descending

 Clone ID
Defining Citation

Sort Ascending

Sort Descending

 Comments
Clonality

Sort Ascending

Sort Descending

 Host Organism

Sort Ascending

Sort Descending

 Antibody ID
Vendor

Sort Ascending

Sort Descending

 Catalog Number
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
Anti-SERINC4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA018526, RRID:AB_2185280 SERINC4 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EASYLAEVFGPLWIVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQHLSYNYS; Manufacturer approved use: IHC polyclonal rabbit AB_2185280 Atlas Antibodies HPA018526 2025-08-19 11:22:38 0
SUPT6H Antibody
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data 		Thermo Fisher Scientific Cat# A300-801A, RRID:AB_577215 SUPT6H mouse, human Discontinued; Applications: WB (1:2,000-1:10,000), IHC (1:200-1:1,000), IP (2-5 µg/mg lysate) polyclonal rabbit AB_577215 Thermo Fisher Scientific A300-801A 2025-08-19 11:22:01 3
Anti-THAP11 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA041434, RRID:AB_10960385 THAP11 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable polyclonal AB_10960385 Sigma-Aldrich HPA041434 2025-08-19 11:22:44 0
CD 20, B-lymphocyte cell-surface antigen B1
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Cell Marque Cat# 120M-85, RRID:AB_1158146 ND [L26] Used By NYUIHC-1057
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE 		monoclonal mouse AB_1158146 Cell Marque 120M-85 2025-08-19 11:22:55 1
Mouse VEGFR2/KDR/Flk-1 Antibody
 
Resource Report
Resource Website
10+ mentions
Rating or validation data 		R and D Systems Cat# AF644, RRID:AB_355500 VEGFR2/KDR/Flk-1 Mouse Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Neutralization, CyTOF-ready polyclonal Goat AB_355500 R and D Systems AF644 (also AF644-SP) 2025-08-19 11:19:15 20
Human Artemin Antibody
 
Resource Report
Resource Website
Rating or validation data 		R and D Systems Cat# AF2589, RRID:AB_2058564 Artemin Human Applications: Western Blot, Immunohistochemistry polyclonal Goat AB_2058564 R and D Systems AF2589 (also AF2589-SP) 2025-08-19 11:19:15 0
Anti-SPAST polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA017311, RRID:AB_1857415 SPAST rat, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1857415 Atlas Antibodies HPA017311 2025-08-19 11:19:19 0
Anti-MRPS22 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA007830, RRID:AB_1854123 MRPS22 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other polyclonal rabbit AB_1854123 Sigma-Aldrich HPA007830 2025-08-19 11:19:48 0
Anti-MTHFSD antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA041333, RRID:AB_10795006 MTHFSD antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_10795006 Sigma-Aldrich HPA041333 2025-08-19 11:19:16 0
Anti-C17orf39 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA044348, RRID:AB_10959602 C17orf39 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable polyclonal AB_10959602 Sigma-Aldrich HPA044348 2025-08-19 11:19:16 0
Anti-ABTB2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA020065, RRID:AB_1844459 ABTB2 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1844459 Sigma-Aldrich HPA020065 2025-08-19 11:19:38 0
Anti-CHADL polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA024654, RRID:AB_1846615 CHADL human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1846615 Atlas Antibodies HPA024654 2025-08-19 11:20:11 0
Rat monoclonal anti-mouse endothelial cell marker CD31 (PECAM-1)
 
Resource Report
Resource Website
10+ mentions
Rating or validation data 		Dianova Cat# DIA-310, RRID:AB_2631039 CD31 pig, mouse SZ31 Info: Used by Czech Centre for Phenogenomics monoclonal rat AB_2631039 Dianova DIA-310 (also DIA-310-M) 2025-08-19 11:19:49 38
Anti-HADHB
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA066099, RRID:AB_2685618 HADHB human Originating manufacturer of this product. Applications: ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2685618 Atlas Antibodies HPA066099 2025-08-19 11:19:54 0
Anti-CENPH antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA036494, RRID:AB_10673354 CENPH antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10673354 Sigma-Aldrich HPA036494 2025-08-19 11:20:12 0
Anti-OXNAD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA036830, RRID:AB_2675338 OXNAD1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675338 Atlas Antibodies HPA036830 2025-08-19 11:19:53 0
Anti-ZNF48 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA023806, RRID:AB_1859335 Human ZNF48 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1859335 Sigma-Aldrich HPA023806 2025-08-19 11:20:22 0
Anti-WASHC2A
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA047844, RRID:AB_2680177 WASHC2A human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680177 Atlas Antibodies HPA047844 2025-08-19 11:20:18 0
Cyclin D1
 
Resource Report
Resource Website
Rating or validation data 		Innovative Research Cat# 18-0220, RRID:AB_2336030 ND [AM29] Used By NYUIHC-24
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE 		monoclonal mouse AB_2336030 Innovative Research 18-0220 2025-08-19 11:22:58 0
Anti-TFB1M
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA029428, RRID:AB_2673038 TFB1M human unknown rabbit AB_2673038 Sigma-Aldrich HPA029428 2025-08-19 11:23:15 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join Dr. Chen Li for a Knowledge Portal Network Webinar on the dkNET Computational Core on August 6

Join NIH ODSS Data Sharing and Reuse Seminar "PanKbase: An Open, FAIR Knowledge Base of the Human Pancreas to Accelerate Diabetes Research"

Join the NIDDK-CR Webinar "Design Patterns for Reproducible Research" on July 29, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch