Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-TM2D2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA047152, RRID:AB_2679957 TM2D2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679957 Atlas Antibodies HPA047152 2025-08-19 11:29:04 0
H3K27me2-dmelanogaster
 
Resource Report
Resource Website
Rating or validation data
Thomas Jenuwein Cat# non-commercial H3K27me2 modENCODE antibody 1, RRID:AB_2616511 H3K27me2 drosophila melanogaster ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization unknown rabbit AB_2616511 Thomas Jenuwein non-commercial H3K27me2 modENCODE antibody 1 (also ENCAB750SJL) 2025-08-19 11:29:12 0
Anti-PRM1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA055150, RRID:AB_2682718 PRM1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682718 Atlas Antibodies HPA055150 2025-08-19 11:29:04 0
Anti-FBLN5 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA000868, RRID:AB_1078619 FBLN5 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Western Blot; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1078619 Sigma-Aldrich HPA000868 2025-08-19 11:29:27 0
Anti-KDM5A antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA006201, RRID:AB_1079160 KDM5A antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1079160 Sigma-Aldrich HPA006201 2025-08-19 11:29:44 0
Anti-ASB8 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA003299, RRID:AB_1845072 ASB8 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; Immunofluorescence; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1845072 Sigma-Aldrich HPA003299 2025-08-19 11:29:32 0
Anti-LIPT1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA034802, RRID:AB_10669851 LIPT1 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10669851 Sigma-Aldrich HPA034802 2025-08-19 11:29:56 0
Anti-C11orf70 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA038585, RRID:AB_10795357 C11orf70 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10795357 Sigma-Aldrich HPA038585 2025-08-19 11:29:59 0
Anti-USP46 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA007288, RRID:AB_1080531 Human USP46 human Vendor recommendations: unknown rabbit AB_1080531 Sigma-Aldrich HPA007288 2025-08-19 11:29:59 0
Anti-GNE antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA007045, RRID:AB_1079003 Human GNE human Vendor recommendations: unknown rabbit AB_1079003 Sigma-Aldrich HPA007045 2025-08-19 11:29:58 0
Anti-HOOK1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA018537, RRID:AB_1850907 HOOK1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry polyclonal rabbit AB_1850907 Sigma-Aldrich HPA018537 2025-08-19 11:30:05 0
Anti-NeuN antibody [EPR12763]
 
Resource Report
Resource Website
100+ mentions
Rating or validation data
Abcam Cat# ab177487, RRID:AB_2532109 NeuN rat, goat, mouse, cat, marmoset, zebrafish, dog, human, sheep EPR12763 IHC-FoFr, Flow Cyt, IHC-Fr, IHC-P, WB, ICC/IF monoclonal rabbit AB_2532109 Abcam ab177487 2025-08-19 11:22:20 247
Anti-MAP4K1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA007419, RRID:AB_1853778 MAP4K1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1853778 Atlas Antibodies HPA007419 2025-08-19 11:21:47 0
Anti-KLHL28 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA000988, RRID:AB_1845480 KLHL28 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1845480 Atlas Antibodies HPA000988 2025-08-19 11:21:46 0
Anti-SPOCK1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA007450, RRID:AB_10603116 SPOCK1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603116 Atlas Antibodies HPA007450 2025-08-19 11:21:47 0
Anti-C1orf112
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA023778, RRID:AB_1848665 C1orf112 human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1848665 Atlas Antibodies HPA023778 2025-08-19 11:21:48 1
Anti-ADCY5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA017730, RRID:AB_1844595 ADCY5 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YLKEHSIETFLTLRCTQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGRAIDARSIDRLRS; Manufacturer approved use: ICC-IF, IHC polyclonal rabbit AB_1844595 Atlas Antibodies HPA017730 2025-08-19 11:22:38 0
Pumilio 2 Antibody
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Thermo Fisher Scientific Cat# A300-202A, RRID:AB_2173752 Pumilio 2 mouse, human Discontinued; Applications: WB (1:10,000-1:20,000), IP (5-10 µg/mg lysate) polyclonal rabbit AB_2173752 Thermo Fisher Scientific A300-202A 2025-08-19 11:21:52 5
Anti-KRT23
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA016959, RRID:AB_1852228 KRT23 human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1852228 Atlas Antibodies HPA016959 2025-08-19 11:21:47 0
Anti-PLXNB2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003100, RRID:AB_1079638 PLXNB2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079638 Atlas Antibodies HPA003100 2025-08-19 11:21:46 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.