Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2159706
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Western Blot; Immunofluorescence; WB, IP, IF, ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): Pax-6 (H-295)
Proper citation: Santa Cruz Biotechnology Cat# sc-11357, RRID:AB_2159706 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2889189
Comments:
Host Organism:
Clonality monoclonal
Target(s): CD3
Proper citation: Abcam Cat# ab11089, RRID:AB_2889189 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849931
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human GPLD1
Proper citation: Sigma-Aldrich Cat# HPA012500, RRID:AB_1849931 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844820
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ANGPT1
Proper citation: Sigma-Aldrich Cat# HPA018793, RRID:AB_1844820 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601966
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): AF130358.1 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA027071, RRID:AB_10601966 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602106
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): ADARB1 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA029645, RRID:AB_10602106 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078363
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): C9orf46
Proper citation: Sigma-Aldrich Cat# HPA008214, RRID:AB_1078363 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601861
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRIM8
Proper citation: Atlas Antibodies Cat# HPA023561, RRID:AB_10601861 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601154
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RABL3
Proper citation: Atlas Antibodies Cat# HPA035151, RRID:AB_10601154 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675568
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): ENKUR
Proper citation: Sigma-Aldrich Cat# HPA037594, RRID:AB_2675568 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603237
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEP; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): S1PR5
Proper citation: Atlas Antibodies Cat# HPA029683, RRID:AB_10603237 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615917
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 20141229.LRH.LAS for not specified; status is not pursued
Host Organism: mouse
Clonality unknown
Target(s): ZNF783
Proper citation: CDI Cat# R1257.1.2A8, RRID:AB_2615917 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681110
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): COL13A1
Proper citation: Atlas Antibodies Cat# HPA050392, RRID:AB_2681110 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679590
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGD; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): RASGRP1
Proper citation: Atlas Antibodies Cat# HPA046216, RRID:AB_2679590 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846524
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CENPP
Proper citation: Atlas Antibodies Cat# HPA021787, RRID:AB_1846524 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600812
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SORBS1
Proper citation: Atlas Antibodies Cat# HPA027559, RRID:AB_10600812 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616446
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): hda-1
Proper citation: SDIX Cat# 2217.00.02, RRID:AB_2616446 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684677
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM167B
Proper citation: Atlas Antibodies Cat# HPA062074, RRID:AB_2684677 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675362
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RIF1
Proper citation: Atlas Antibodies Cat# HPA036888, RRID:AB_2675362 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683898
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): HGFAC
Proper citation: Sigma-Aldrich Cat# HPA059076, RRID:AB_2683898 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.