Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-ASB5 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028870, RRID:AB_10611679 ASB5 antibody produced in rabbit human polyclonal rabbit AB_10611679 Atlas Antibodies HPA028870 2025-08-19 11:56:32 0
Anti-PTOV1 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA075125, RRID:AB_2732280 PTOV1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732280 Atlas Antibodies HPA075125 2025-08-19 11:57:03 0
SFRS10 (splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)) Antibody (against the middle region of SFRS10) (100ug)
 
Resource Report
Resource Website
Rating or validation data
Aviva Systems Biology Cat# ARP40529_T100, RRID:AB_842530 SFRS10 (splicing factor arginine/serine-rich 10 (transformer 2 homolog Drosophila)) (against the middle region of SFRS10) (100ug) chicken, rat, porcine, canine, chicken/bird, pig, mouse, zebrafish/fish, bovine, african clawed frog, xenopus/amphibian, zebrafish, human, dog manufacturer recommendations: IgG WB, IHC; ELISA; Western Blot; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615136, AB_842530. polyclonal rabbit AB_842530 Aviva Systems Biology ARP40529_T100 2025-08-19 11:57:18 0
F4/80 antibody [CI:A3-1]
 
Resource Report
Resource Website
100+ mentions
Rating or validation data
Abcam Cat# ab6640, RRID:AB_1140040 F4/80 antibody [CI:A3-1] mouse, human Applications: Immunoprecipitation; Immunofluorescence; Immunohistochemistry; Flow Cytometry; Western Blot; Immunocytochemistry; Immunohistochemistry - fixed; Flow Cyt, ICC/IF, IHC-FoFr, IHC-Fr, IHC-P, IHC-R, IP, RIA, WB; Immunohistochemistry - frozen; Radioimmunoassay
Info: Used by Czech Centre for Phenogenomics
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
monoclonal rat AB_1140040 Abcam ab6640 2025-08-19 11:56:52 139
Anti-PDCL2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048260, RRID:AB_2680333 PDCL2 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2680333 Atlas Antibodies HPA048260 2025-08-19 11:53:54 0
Anti-MGST3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA053311, RRID:AB_2682108 MGST3 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682108 Atlas Antibodies HPA053311 2025-08-19 11:53:18 0
Anti-OR8B4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049884, RRID:AB_2680932 OR8B4 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TFTYLTTSFPGSMNHGRFASVF; Manufacturer approved use: IHC polyclonal rabbit AB_2680932 Atlas Antibodies HPA049884 2025-08-19 11:53:18 0
Anti-SEPT7
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA023309, RRID:AB_10600093 SEPT7 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10600093 Atlas Antibodies HPA023309 2025-08-19 11:53:18 0
Anti-FAM170B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043899, RRID:AB_2678721 FAM170B human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678721 Atlas Antibodies HPA043899 2025-08-19 11:53:18 0
Anti-SMN1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045271, RRID:AB_2679280 SMN1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679280 Atlas Antibodies HPA045271 2025-08-19 11:53:18 0
Anti-BLMH
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA064307, RRID:AB_2685241 BLMH human unknown rabbit AB_2685241 Sigma-Aldrich HPA064307 2025-08-19 11:53:19 0
Anti-MPZL2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051395, RRID:AB_2681466 MPZL2 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2681466 Atlas Antibodies HPA051395 2025-08-19 11:53:54 0
Anti-LARS polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040881, RRID:AB_2677185 LARS human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677185 Atlas Antibodies HPA040881 2025-08-19 11:53:18 0
Anti-CCNH polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044138, RRID:AB_2678828 CCNH human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678828 Atlas Antibodies HPA044138 2025-08-19 11:53:54 0
Anti-HHIPL1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052767, RRID:AB_2681941 HHIPL1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681941 Atlas Antibodies HPA052767 2025-08-19 11:53:54 0
Anti-DSE polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA014764, RRID:AB_1856587 DSE human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1856587 Atlas Antibodies HPA014764 2025-08-19 11:53:17 0
Anti-WDR3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054354, RRID:AB_2682459 WDR3 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682459 Atlas Antibodies HPA054354 2025-08-19 11:53:54 0
Anti-ZBTB5 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA021521, RRID:AB_2670736 ZBTB5 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2670736 Atlas Antibodies HPA021521 2025-08-19 11:53:53 1
Anti-NPTX2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049799, RRID:AB_2680889 NPTX2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680889 Atlas Antibodies HPA049799 2025-08-19 11:53:54 0
Anti-HOXA7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA074048, RRID:AB_2686655 HOXA7 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686655 Atlas Antibodies HPA074048 2025-08-19 11:53:55 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.