Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963572
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DDX60
Proper citation: Atlas Antibodies Cat# HPA046952, RRID:AB_10963572 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2152469
Comments: validation status unknown, seller recommendations provided in 2012: Flow Cytometry; Immunohistochemistry; Immunoprecipitation; Western Blot; Flow Cytometry, Immunohistochemistry-P, Immunoprecipitation, Western Blot
Host Organism: rabbit
Clonality monoclonal
Target(s): nNOS (neuronal)
Proper citation: Abcam Cat# ab76067, RRID:AB_2152469 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685618
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): HADHB
Proper citation: Atlas Antibodies Cat# HPA066099, RRID:AB_2685618 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673354
Comments: Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CENPH antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA036494, RRID:AB_10673354 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675338
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OXNAD1
Proper citation: Atlas Antibodies Cat# HPA036830, RRID:AB_2675338 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859335
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ZNF48
Proper citation: Sigma-Aldrich Cat# HPA023806, RRID:AB_1859335 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680177
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): WASHC2A
Proper citation: Atlas Antibodies Cat# HPA047844, RRID:AB_2680177 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961012
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): NCBP2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044850, RRID:AB_10961012 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845912
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): CALCRL antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA008070, RRID:AB_1845912 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963836
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): IL17REL antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045546, RRID:AB_10963836 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965694
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): FAM36A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043617, RRID:AB_10965694 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848015
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): NECAB1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA025963, RRID:AB_1848015 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849698
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): TNFSF18
Proper citation: Atlas Antibodies Cat# HPA012699, RRID:AB_1849698 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847244
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human DPYSL2
Proper citation: Sigma-Aldrich Cat# HPA002381, RRID:AB_1847244 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844619
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ADPRHL2
Proper citation: Sigma-Aldrich Cat# HPA027141, RRID:AB_1844619 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858093
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human TMEM146
Proper citation: Sigma-Aldrich Cat# HPA024056, RRID:AB_1858093 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855557
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human KCNQ5
Proper citation: Sigma-Aldrich Cat# HPA016655, RRID:AB_1855557 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2281256
Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): LMBRD1
Proper citation: Sigma-Aldrich Cat# HPA019547, RRID:AB_2281256 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848405
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human FAM69A
Proper citation: Sigma-Aldrich Cat# HPA015718, RRID:AB_1848405 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10618789
Comments: Applications: WB, ICC/IF, IHC-P, IP
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4724169
Host Organism: rabbit
Clonality polyclonal
Target(s): Moesin
Proper citation: GeneTex Cat# GTX101708, RRID:AB_10618789 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
