Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Leptin receptor, pAb Resource Report Resource Website |
Enzo Life Sciences Cat# ALX-210-168, RRID:AB_2234637 | LEPR | rat, mouse, human | Useful for western blot | polyclonal | guinea pig | AB_2234637 | Enzo Life Sciences | ALX-210-168 | 2025-08-20 05:48:25 | 0 | ||
|
Guinea pig Anti-Rat Vanilloid receptor 1 Polyclonal Antibody, Unconjugated Resource Report Resource Website Discontinued |
GeneTex Cat# GTX30185, RRID:AB_379412 | Rat Vanilloid receptor 1 | rat | Discontinued; manufacturer recommendations: Immunohistochemistry; IHC | polyclonal | guinea pig | AB_379412 | GeneTex | GTX30185 | 2025-08-20 05:45:58 | 0 | ||
|
PKCa (protein kinase C alpha) antibody Resource Report Resource Website |
Frontier Institute Cat# PKCa-GP, RRID:AB_2571821 | mouse PKCa, 660-672 aa (M25811) | polyclonal | guinea pig | AB_2571821 | Frontier Institute | PKCa-GP | 2025-08-20 05:46:37 | 0 | ||||
|
Guinea Pig Anti-Ornithine Decarboxylase Antibody, Unconjugated Resource Report Resource Website |
Acris Antibodies Cat# EUD2551, RRID:AB_1005892 | Ornithine Decarboxylase | rat, mouse, human | manufacturer recommendations: Immunofluorescence; Immunohistochemistry; Immunohistochemistry-frozen, Immunofluorescence, Immunohistochemistry-paraffin | unknown | guinea pig | AB_1005892 | Acris Antibodies | EUD2551 | 2025-08-20 05:47:03 | 0 | ||
|
Lipoma Preferred Partner, pAb Resource Report Resource Website |
Enzo Life Sciences Cat# ALX-210-264, RRID:AB_2138584 | Lpp | rat, human | Useful for western blot, immunoprecipitation, immunocytochemistry | polyclonal | guinea pig | AB_2138584 | Enzo Life Sciences | ALX-210-264 | 2025-08-20 06:00:52 | 0 | ||
|
Sox11 antibody Resource Report Resource Website 1+ mentions |
Elisabeth Sock and Michael Wegner; University of Erlangen-Nuremberg; Germany Cat# gpSox11, RRID:AB_2722601 | Sox11 | rat, mouse, human | PMID:18505825 | works in Western & immunohistochemistry. Hoser M, Potzner MR, Koch JM, Bösl MR, Wegner M, Sock E. (2008) Mol Cell Biol. 28:4675-4687; "anti-Sox11 guinea pig antiserum (1:1,000 dilution; generated against a peptide spanning amino acids 204 to 285 of rat Sox11)" | polyclonal | guinea pig | AB_2722601 | Elisabeth Sock and Michael Wegner; University of Erlangen-Nuremberg; Germany | gpSox11 | 2025-08-20 06:01:27 | 1 | |
|
KV2.1 (KCNB1) Polyclonal Antibody Resource Report Resource Website |
Thermo Fisher Scientific Cat# PA5-111830, RRID:AB_2857239 | KV2.1 (KCNB1) | Rat, Mouse | Applications: ICC/IF (Assay-dependent), IHC (1:400), WB (1:500) | polyclonal | guinea pig | AB_2857239 | Thermo Fisher Scientific | PA5-111830 | 2025-08-20 06:02:17 | 0 | ||
|
Guinea Pig Anti-Human Keratin K16 Polyclonal Antibody Resource Report Resource Website |
Creative Diagnostics Cat# DPAB2315GH, RRID:AB_2397008 | human | unknown | guinea pig | AB_2397008 | Creative Diagnostics | DPAB2315GH | 2025-08-20 06:02:35 | 0 | ||||
|
CGRP (calcitonin gene-related peptide) antibody Resource Report Resource Website |
Frontier Institute Cat# CGRP-GP, RRID:AB_2572275 | polyclonal | guinea pig | AB_2572275 | Frontier Institute | CGRP-GP | 2025-08-20 06:02:42 | 0 | |||||
|
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum Resource Report Resource Website |
Biosensis Cat# GP-029-50, RRID:AB_2492388 | A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response. | rat and sheep. Other species have not yet been tested, This antibody is known to react with human | IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user. | unknown | guinea pig | AB_2492388 | Biosensis | GP-029-50 | 2025-08-20 06:02:40 | 0 | ||
|
Guinea pig Anti-Nociceptin Polyclonal Antibody, Unconjugated Resource Report Resource Website |
GenWay Biotech Inc. Cat# GWB-DFDF88, RRID:AB_10273732 | Guinea pig Nociceptin | manufacturer recommendations: IgG Immunohistochemistry-Fr; Immunohistochemistry | polyclonal | guinea pig | AB_10273732 | GenWay Biotech Inc. | GWB-DFDF88 | 2025-08-20 06:03:04 | 0 | |||
|
Dynamin I (rat), pAb Resource Report Resource Website |
Enzo Life Sciences Cat# ALX-210-207, RRID:AB_2093515 | Dnm1 | rat | Useful for western blot | polyclonal | guinea pig | AB_2093515 | Enzo Life Sciences | ALX-210-207 | 2025-08-20 06:21:20 | 0 | ||
|
Anti-nNOS Resource Report Resource Website 1+ mentions |
Frontier Institute Cat# nNOS-GP, RRID:AB_2571816 | nNOS, C-terminal 15 aa | mouse | Consolidation 4/2022: AB_2571816, AB_2571733 | polyclonal | guinea pig | AB_2571816 | Frontier Institute | nNOS-GP | 2025-08-20 06:21:38 | 1 | ||
|
ProDynorphin antibody Resource Report Resource Website Discontinued |
GeneTex Cat# GTX10279, RRID:AB_380970 | ProDynorphin antibody | guinea pig | Discontinued; manufacturer recommendations: IgG; IgG Immunohistochemistry, IHC (Frozen sections). IHC-Fr: Use at a dilution of 1/500. Not tested in other applications. Optimal dilutions/concentrations should be determined by the end user.; Immunohistochemistry - frozen; Immunohistochemistry | polyclonal | guinea pig | AB_380970 | GeneTex | GTX10279 | 2025-08-20 06:22:43 | 0 | ||
|
Adrenergic receptor alpha2a, pAb Resource Report Resource Website |
Enzo Life Sciences Cat# ALX-210-147, RRID:AB_2225233 | Adra2a | mouse | Useful for western blot, immunohistochemistry | polyclonal | guinea pig | AB_2225233 | Enzo Life Sciences | ALX-210-147 | 2025-08-20 06:22:49 | 0 | ||
|
Insulin antibody Resource Report Resource Website |
Abcam Cat# ab30759, RRID:AB_775678 | Insulin antibody | porcine, pig, human | validation status unknown, seller recommendations provided in 2012: ELISA; ELISA | polyclonal | guinea pig | AB_775678 | Abcam | ab30759 | 2025-08-20 06:23:25 | 0 | ||
|
Guinea Pig anti Peroxidase (HRP) Antibody (2ml) Resource Report Resource Website |
Aviva Systems Biology Cat# OAMA03282, RRID:AB_10869241 | Guinea Pig anti Peroxidase (HRP) (2ml) | manufacturer recommendations: EIA/E, IEP | unknown | guinea pig | AB_10869241 | Aviva Systems Biology | OAMA03282 | 2025-08-20 06:04:10 | 0 | |||
|
Caveolin-1, pAb Resource Report Resource Website |
Enzo Life Sciences Cat# ALX-210-347, RRID:AB_2259794 | Cav1 | rat, mouse, dog | Useful for western blot, immunoprecipitation | polyclonal | guinea pig | AB_2259794 | Enzo Life Sciences | ALX-210-347 | 2025-08-20 06:04:52 | 0 | ||
|
Anti-DARPP 32 Resource Report Resource Website 1+ mentions |
Synaptic Systems Cat# 382 004, RRID:AB_2721081 | DARPP 32 | Rat, Mouse | Applications: WB,IHC,IHC-P | polyclonal | guinea pig | AB_2721081 | Synaptic Systems | 382 004 | 2025-08-20 06:05:07 | 1 | ||
|
Protachykinin Beta (TAC1) Guinea Pig anti-Rat Polyclonal (aa1-11) Antibody Resource Report Resource Website |
LSBio (LifeSpan) Cat# LS-C86250, RRID:AB_2200313 | Tac1 | rat, human | vendor suggested use: | polyclonal | guinea pig | AB_2200313 | LSBio (LifeSpan) | LS-C86250 | 2025-08-20 06:13:15 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
