Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_2234637
Comments: Useful for western blot
Host Organism: guinea pig
Clonality: polyclonal
Target(s): LEPR
Proper citation: Enzo Life Sciences Cat# ALX-210-168, RRID:AB_2234637 Copy
Discontinued
http://antibodyregistry.org/AB_379412
Comments: Discontinued; manufacturer recommendations: Immunohistochemistry; IHC
Host Organism: guinea pig
Clonality: polyclonal
Target(s): Rat Vanilloid receptor 1
Proper citation: GeneTex Cat# GTX30185, RRID:AB_379412 Copy
http://antibodyregistry.org/AB_2571821
Host Organism: guinea pig
Clonality: polyclonal
Target(s): mouse PKCa, 660-672 aa (M25811)
Proper citation: Frontier Institute Cat# PKCa-GP, RRID:AB_2571821 Copy
http://antibodyregistry.org/AB_1005892
Comments: manufacturer recommendations: Immunofluorescence; Immunohistochemistry; Immunohistochemistry-frozen, Immunofluorescence, Immunohistochemistry-paraffin
Host Organism: guinea pig
Clonality: unknown
Target(s): Ornithine Decarboxylase
Proper citation: Acris Antibodies Cat# EUD2551, RRID:AB_1005892 Copy
http://antibodyregistry.org/AB_2138584
Comments: Useful for western blot, immunoprecipitation, immunocytochemistry
Host Organism: guinea pig
Clonality: polyclonal
Target(s): Lpp
Proper citation: Enzo Life Sciences Cat# ALX-210-264, RRID:AB_2138584 Copy
http://antibodyregistry.org/AB_2722601
Comments: works in Western & immunohistochemistry. Hoser M, Potzner MR, Koch JM, Bösl MR, Wegner M, Sock E. (2008) Mol Cell Biol. 28:4675-4687; "anti-Sox11 guinea pig antiserum (1:1,000 dilution; generated against a peptide spanning amino acids 204 to 285 of rat Sox11)"
Host Organism: guinea pig
Clonality: polyclonal
Target(s): Sox11
Proper citation: Elisabeth Sock and Michael Wegner; University of Erlangen-Nuremberg; Germany Cat# gpSox11, RRID:AB_2722601 Copy
http://antibodyregistry.org/AB_2857239
Comments: Applications: ICC/IF (Assay-dependent), IHC (1:400), WB (1:500)
Host Organism: guinea pig
Clonality: polyclonal
Target(s): KV2.1 (KCNB1)
Proper citation: Thermo Fisher Scientific Cat# PA5-111830, RRID:AB_2857239 Copy
http://antibodyregistry.org/AB_2397008
Host Organism: guinea pig
Clonality: unknown
Proper citation: Creative Diagnostics Cat# DPAB2315GH, RRID:AB_2397008 Copy
http://antibodyregistry.org/AB_2572275
Host Organism: guinea pig
Clonality: polyclonal
Proper citation: Frontier Institute Cat# CGRP-GP, RRID:AB_2572275 Copy
http://antibodyregistry.org/AB_2492388
Comments: IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Host Organism: guinea pig
Clonality: unknown
Target(s): A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Proper citation: Biosensis Cat# GP-029-50, RRID:AB_2492388 Copy
http://antibodyregistry.org/AB_10273732
Comments: manufacturer recommendations: IgG Immunohistochemistry-Fr; Immunohistochemistry
Host Organism: guinea pig
Clonality: polyclonal
Target(s): Guinea pig Nociceptin
Proper citation: GenWay Biotech Inc. Cat# GWB-DFDF88, RRID:AB_10273732 Copy
http://antibodyregistry.org/AB_2093515
Comments: Useful for western blot
Host Organism: guinea pig
Clonality: polyclonal
Target(s): Dnm1
Proper citation: Enzo Life Sciences Cat# ALX-210-207, RRID:AB_2093515 Copy
http://antibodyregistry.org/AB_2571816
Comments: Consolidation 4/2022: AB_2571816, AB_2571733
Host Organism: guinea pig
Clonality: polyclonal
Target(s): nNOS, C-terminal 15 aa
Proper citation: Frontier Institute Cat# nNOS-GP, RRID:AB_2571816 Copy
Discontinued
http://antibodyregistry.org/AB_380970
Comments: Discontinued; manufacturer recommendations: IgG; IgG Immunohistochemistry, IHC (Frozen sections). IHC-Fr: Use at a dilution of 1/500. Not tested in other applications. Optimal dilutions/concentrations should be determined by the end user.; Immunohistochemistry - frozen; Immunohistochemistry
Host Organism: guinea pig
Clonality: polyclonal
Target(s): ProDynorphin antibody
Proper citation: GeneTex Cat# GTX10279, RRID:AB_380970 Copy
http://antibodyregistry.org/AB_2225233
Comments: Useful for western blot, immunohistochemistry
Host Organism: guinea pig
Clonality: polyclonal
Target(s): Adra2a
Proper citation: Enzo Life Sciences Cat# ALX-210-147, RRID:AB_2225233 Copy
http://antibodyregistry.org/AB_775678
Comments: validation status unknown, seller recommendations provided in 2012: ELISA; ELISA
Host Organism: guinea pig
Clonality: polyclonal
Target(s): Insulin antibody
Proper citation: Abcam Cat# ab30759, RRID:AB_775678 Copy
http://antibodyregistry.org/AB_10869241
Comments: manufacturer recommendations: EIA/E, IEP
Host Organism: guinea pig
Clonality: unknown
Target(s): Guinea Pig anti Peroxidase (HRP) (2ml)
Proper citation: Aviva Systems Biology Cat# OAMA03282, RRID:AB_10869241 Copy
http://antibodyregistry.org/AB_2259794
Comments: Useful for western blot, immunoprecipitation
Host Organism: guinea pig
Clonality: polyclonal
Target(s): Cav1
Proper citation: Enzo Life Sciences Cat# ALX-210-347, RRID:AB_2259794 Copy
http://antibodyregistry.org/AB_2721081
Comments: Applications: WB,IHC,IHC-P
Host Organism: guinea pig
Clonality: polyclonal
Target(s): DARPP 32
Proper citation: Synaptic Systems Cat# 382 004, RRID:AB_2721081 Copy
http://antibodyregistry.org/AB_2200313
Comments: vendor suggested use:
Host Organism: guinea pig
Clonality: polyclonal
Target(s): Tac1
Proper citation: LSBio (LifeSpan) Cat# LS-C86250, RRID:AB_2200313 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
