Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
TLR2 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA0821) Resource Report Resource Website |
Thermo Fisher Scientific Cat# MA5-54740, RRID:AB_3666988 | TLR2 VHH-8His-Cys-tag | Mouse | clone SAA0821 | Applications: ELISA, Neu | recombinant monoclonal | Alpaca | AB_3666988 | Thermo Fisher Scientific | MA5-54740 | 2025-08-20 10:18:54 | 0 | |
|
Methotrexate VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1192) Resource Report Resource Website |
Thermo Fisher Scientific Cat# MA5-54328, RRID:AB_3666578 | Methotrexate VHH-8His-Cys-tag | Chemical | clone SAA1192 | Applications: ELISA | recombinant monoclonal | Alpaca | AB_3666578 | Thermo Fisher Scientific | MA5-54328 | 2025-08-20 10:14:25 | 0 | |
|
FluoTag®-X2 anti-CD45 Atto488 Resource Report Resource Website |
NanoTag Biotechnologies Cat# N4202-AT488-L, RRID:AB_3076130 | human CD45 | human cd45 | clone 4B7 | Applications: IF, FACS | monoclonal | Alpaca | AB_3076130 | NanoTag Biotechnologies | N4202-AT488-L (also N4202-AT488-S) | 2025-08-20 08:35:29 | 0 | |
|
sdAb anti-Ubiquitin K48 Biotin Resource Report Resource Website |
NanoTag Biotechnologies Cat# N1805-Biotin, RRID:AB_3076011 | Ubi K48 linkage | ubi k48 linkage | clone A4-1 | Applications: IP | monoclonal | Alpaca | AB_3076011 | NanoTag Biotechnologies | N1805-Biotin | 2025-08-20 08:35:40 | 0 | |
|
FluoTag®-X2 anti-Mouse IgG2a/b AZDye568 Resource Report Resource Website |
NanoTag Biotechnologies Cat# N2702-AF568-S, RRID:AB_3076052 | Mouse IgG2, does not cross-react with rabbit, guinea pig or chicken immunoglobulins | guinea pig or chicken immunoglobulins, mouse igg2, does not cross-react with rabbit | clone 14A4 | Applications: IF, WB | monoclonal | Alpaca | AB_3076052 | NanoTag Biotechnologies | N2702-AF568-S (also N2702-AF568-L) | 2025-08-20 09:59:44 | 0 | |
|
iST HA-Trap IP-MS Sample Preparation Kit Resource Report Resource Website |
ChromoTek Cat# atak-iST, RRID:AB_3674441 | HA-Tag (sequence YPYDVPDYA) | Applications: IP, Co-IP, MS | unknown | Alpaca | AB_3674441 | ChromoTek | atak-iST | 2025-08-20 10:12:14 | 0 | |||
|
Alexa Fluor® 488-conjugated AffiniPure VHH Fragment Alpaca Anti-Mouse IgG (H+L) (min X Bov, Hu, Rb Sr Prot) Resource Report Resource Website |
Jackson ImmunoResearch Labs Cat# 615-544-214, RRID:AB_2922874 | IgG (H+L) | mouse | polyclonal secondary | alpaca | AB_2922874 | Jackson ImmunoResearch Labs | 615-544-214 | 2025-08-20 10:00:12 | 0 | |||
|
FluoTag®-X4 anti-Rabbit IgG AZDye568 Resource Report Resource Website |
NanoTag Biotechnologies Cat# N2404-AF568-S, RRID:AB_3076042 | Rabbit IgG, does not cross-react with mouse, guinea pig or chicken immunoglobulins | does not cross-react with mouse, guinea pig or chicken immunoglobulins, rabbit igg | clone 10E10 / 8C10 | Applications: IF, WB | monoclonal | Alpaca | AB_3076042 | NanoTag Biotechnologies | N2404-AF568-S (also N2404-AF568-L) | 2025-08-20 10:06:56 | 0 | |
|
sdAb anti-PSD95 unconjugated Resource Report Resource Website |
NanoTag Biotechnologies Cat# N3705-250ug, RRID:AB_3076107 | Recognizes mouse and rat PSD95. Other species not tested | recognizes mouse and rat psd95. other species not tested | clone 1B2 | Applications: IF,IHC | monoclonal | Alpaca | AB_3076107 | NanoTag Biotechnologies | N3705-250ug | 2025-08-20 10:56:30 | 0 | |
|
FluoTag®-X2 anti-Mouse IgG1 AlexaFluor647 Resource Report Resource Website |
NanoTag Biotechnologies Cat# N2002-AF647-S, RRID:AB_3076020 | Mouse IgG1, does not cross-react with rabbit, guinea pig or chicken immunoglobulins | guinea pig or chicken immunoglobulins, mouse igg1, does not cross-react with rabbit | clone 10A4 | Applications: IF, WB | monoclonal | Alpaca | AB_3076020 | NanoTag Biotechnologies | N2002-AF647-S (also N2002-AF647-L) | 2025-08-20 10:57:26 | 0 | |
|
sdAb anti-TagFP DBCO Resource Report Resource Website |
NanoTag Biotechnologies Cat# N0505-DBCO, RRID:AB_3075941 | mTagBFP, mKate, mKate2, mTagRFP, mTagRFP657 | mkate, mtagrfp, mkate2, mtagrfp657, mtagbfp | clone 1H7 | Applications: IF | monoclonal | Alpaca | AB_3075941 | NanoTag Biotechnologies | N0505-DBCO | 2025-08-20 10:52:59 | 0 | |
|
Biotin-SP-conjugated AffiniPure VHH Fragment Alpaca Anti-Human IgG (H+L) (min X Bov, Ms, Rb Sr Prot) Resource Report Resource Website |
Jackson ImmunoResearch Labs Cat# 609-064-213, RRID:AB_2922852 | IgG (H+L) | human | polyclonal secondary | alpaca | AB_2922852 | Jackson ImmunoResearch Labs | 609-064-213 | 2025-08-20 10:45:29 | 0 | |||
|
Strep-NanoTrap Agarose Kit Resource Report Resource Website |
ChromoTek Cat# qtak, RRID:AB_3674450 | Strep-Tag® (sequence: SAWSHPQFEK) and Twin-Strep-Tag® (sequence: SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) | Applications: IP, Co-IP | unknown | Alpaca | AB_3674450 | ChromoTek | qtak | 2025-08-20 10:51:42 | 0 | |||
|
sdAb anti-mEOS DBCO Resource Report Resource Website |
NanoTag Biotechnologies Cat# N3105-DBCO, RRID:AB_3076068 | Recognizes mEOS and mEOS derivatives | recognizes meos and meos derivatives | clone 1E8 | Applications: IF | monoclonal | Alpaca | AB_3076068 | NanoTag Biotechnologies | N3105-DBCO | 2025-08-20 10:48:38 | 0 | |
|
RECQL5 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1134) Resource Report Resource Website |
Thermo Fisher Scientific Cat# MA5-54678, RRID:AB_3666926 | RECQL5 VHH-8His-Cys-tag | Human | clone SAA1134 | Applications: ELISA | recombinant monoclonal | Alpaca | AB_3666926 | Thermo Fisher Scientific | MA5-54678 | 2025-08-20 10:55:34 | 0 | |
|
beta-2 Adrenergic Receptor VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1156) Resource Report Resource Website |
Thermo Fisher Scientific Cat# MA5-54367, RRID:AB_3666617 | beta-2 Adrenergic Receptor VHH-8His-Cys-tag | Human | clone SAA1156 | Applications: Flow | recombinant monoclonal | Alpaca | AB_3666617 | Thermo Fisher Scientific | MA5-54367 | 2025-08-20 10:55:34 | 0 | |
|
NOTCH3 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1288) Resource Report Resource Website |
Thermo Fisher Scientific Cat# MA5-54649, RRID:AB_3666897 | NOTCH3 VHH-8His-Cys-tag | Human | clone SAA1288 | Applications: ELISA | recombinant monoclonal | Alpaca | AB_3666897 | Thermo Fisher Scientific | MA5-54649 | 2025-08-20 10:05:15 | 0 | |
|
MAGEB1 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA0834) Resource Report Resource Website |
Thermo Fisher Scientific Cat# MA5-54629, RRID:AB_3666877 | MAGEB1 VHH-8His-Cys-tag | Human | clone SAA0834 | Applications: ELISA | recombinant monoclonal | Alpaca | AB_3666877 | Thermo Fisher Scientific | MA5-54629 | 2025-08-20 10:05:25 | 0 | |
|
VCAM-1 (CD106) VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (cAbVCAM1-5) Resource Report Resource Website |
Thermo Fisher Scientific Cat# MA5-54421, RRID:AB_3666671 | VCAM-1 (CD106) VHH-8His-Cys-tag | Human | clone cAbVCAM1-5 | Applications: ELISA, Functional | recombinant monoclonal | Alpaca | AB_3666671 | Thermo Fisher Scientific | MA5-54421 | 2025-08-20 10:05:25 | 0 | |
|
FluoTag®-Q anti-GFP Atto643 Resource Report Resource Website |
NanoTag Biotechnologies Cat# N0301-AT643-L, RRID:AB_3075901 | GFP (green fluorescent protein) and common GFP derivatives like EGFP, mEGFP, Sirius, tSapphire, Cerulean, eCFP, mTurquoise, acGFP, Emerald, superecliptic pHluorin, paGFP, superfolder GFP, eYFP, mVenus and Citrine | superfolder gfp, gfp (green fluorescent protein) and common gfp derivatives like egfp, ecfp, superecliptic phluorin, tsapphire, acgfp, sirius, eyfp, mvenus and citrine, megfp, pagfp, mturquoise, cerulean, emerald | clone 1H1 | Applications: IF | monoclonal | Alpaca | AB_3075901 | NanoTag Biotechnologies | N0301-AT643-L (also N0301-AT643-S) | 2025-08-20 09:44:39 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
