Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

54,543 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Authority Vendor Catalog Number Record Last Update Mentions Count
Anti-NEO1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA027805, RRID:AB_10601755) NEO1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601755 Antibody Registry Atlas Antibodies HPA027805 2024-07-24 05:43:26 0
Anti-CASZ1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028222, RRID:AB_10600106) CASZ1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600106 Antibody Registry Atlas Antibodies HPA028222 2024-07-25 01:14:51 0
Anti-USH1C polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028033, RRID:AB_10601782) USH1C human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601782 Antibody Registry Atlas Antibodies HPA028033 2024-07-24 07:33:27 0
Anti-RABIF
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA027715, RRID:AB_10602151) RABIF human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10602151 Antibody Registry Atlas Antibodies HPA027715 2024-07-24 10:16:25 0
Anti-MRPS15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028134, RRID:AB_10600890) MRPS15 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600890 Antibody Registry Atlas Antibodies HPA028134 2024-07-24 06:03:57 0
Anti-SPATA6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028234, RRID:AB_2672532) SPATA6 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672532 Antibody Registry Atlas Antibodies HPA028234 2024-07-24 06:43:45 0
Anti-TPD52L1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA027915, RRID:AB_10602074) TPD52L1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602074 Antibody Registry Atlas Antibodies HPA027915 2024-07-24 06:33:16 0
Anti-ZCCHC11 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA027973, RRID:AB_10603242) ZCCHC11 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603242 Antibody Registry Atlas Antibodies HPA027973 2024-07-24 10:41:02 0
Anti-MAF polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028289, RRID:AB_10602024) MAF human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602024 Antibody Registry Atlas Antibodies HPA028289 2024-11-06 07:46:53 0
Anti-FAM129A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028172, RRID:AB_10599602) FAM129A human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10599602 Antibody Registry Atlas Antibodies HPA028172 2024-07-25 12:54:12 0
Anti-XKR4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028083, RRID:AB_10601025) XKR4 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YAFFHPNGPRFGQSPSCACEDPAAAFTLPPDVATSTLRSISNNRSVVSDRDQKFAERDGCVPVFQVRPTAPSTPSSRPPRIEESVIKIDLFR; Manufacturer approved use: IHC polyclonal rabbit AB_10601025 Antibody Registry Atlas Antibodies HPA028083 2024-07-24 06:32:49 0
Anti-RTCA
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA027982, RRID:AB_10601769) RTCA rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10601769 Antibody Registry Atlas Antibodies HPA027982 2024-07-24 05:49:21 0
Anti-BAD polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028185, RRID:AB_10603445) BAD human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603445 Antibody Registry Atlas Antibodies HPA028185 2024-07-24 05:43:26 0
Anti-CDCA8
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028120, RRID:AB_10670556) CDCA8 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10670556 Antibody Registry Atlas Antibodies HPA028120 2024-07-24 11:58:25 0
Anti-WDTC1
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028182, RRID:AB_10602204) WDTC1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10602204 Antibody Registry Atlas Antibodies HPA028182 2024-07-24 05:57:46 0
Anti-CELA3A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028086, RRID:AB_2672482) CELA3A human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672482 Antibody Registry Atlas Antibodies HPA028086 2024-07-24 06:00:12 0
Anti-DMRT1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
(Atlas Antibodies Cat# HPA027850, RRID:AB_10600868) DMRT1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600868 Antibody Registry Atlas Antibodies HPA027850 2024-07-24 04:14:03 4
Anti-ODF2L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028020, RRID:AB_10601670) ODF2L human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601670 Antibody Registry Atlas Antibodies HPA028020 2024-07-24 06:51:01 0
Anti-STAT5A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA027873, RRID:AB_10603893) STAT5A Human, Rat, Mouse Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603893 Antibody Registry Atlas Antibodies HPA027873 2024-07-24 11:21:26 0
Anti-FMNL1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
(Atlas Antibodies Cat# HPA028288, RRID:AB_10612110) FMNL1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10612110 Antibody Registry Atlas Antibodies HPA028288 2024-07-25 12:14:29 1

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.