Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

54,543 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Authority Vendor Catalog Number Record Last Update Mentions Count
Anti-PTK2B
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026276, RRID:AB_10601234) PTK2B human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10601234 Antibody Registry Atlas Antibodies HPA026276 2024-07-24 10:57:39 0
Anti-EBNA1BP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026512, RRID:AB_1847954) EBNA1BP2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1847954 Antibody Registry Atlas Antibodies HPA026512 2024-11-06 05:49:36 0
Anti-CACYBP polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA025753, RRID:AB_1845878) CACYBP rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1845878 Antibody Registry Atlas Antibodies HPA025753 2024-07-25 02:46:04 0
Anti-RABGGTB polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026585, RRID:AB_1856026) RABGGTB mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1856026 Antibody Registry Atlas Antibodies HPA026585 2024-11-06 02:42:23 0
Anti-ARMC2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA025809, RRID:AB_1845032) ARMC2 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1845032 Antibody Registry Atlas Antibodies HPA025809 2024-07-24 07:54:09 0
Anti-PRKCI polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026574, RRID:AB_1855428) PRKCI rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1855428 Antibody Registry Atlas Antibodies HPA026574 2024-07-24 06:58:13 0
Anti-MRPL37 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA025951, RRID:AB_1854107) MRPL37 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1854107 Antibody Registry Atlas Antibodies HPA025951 2024-11-06 06:50:13 0
Anti-AKT3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026441, RRID:AB_1844711) AKT3 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1844711 Antibody Registry Atlas Antibodies HPA026441 2024-11-06 08:20:22 0
Anti-RAB14
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026419, RRID:AB_1855996) RAB14 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1855996 Antibody Registry Atlas Antibodies HPA026419 2024-11-06 05:40:57 0
Anti-AMIGO3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026673, RRID:AB_1844794) AMIGO3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NNPLPCDCRLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLFVCLATGPRLHHNQTHEY; Manufacturer approved use: IHC polyclonal rabbit AB_1844794 Antibody Registry Atlas Antibodies HPA026673 2024-11-06 07:10:17 0
Anti-CSK polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026488, RRID:AB_1847273) CSK human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1847273 Antibody Registry Atlas Antibodies HPA026488 2024-11-06 02:50:35 0
Anti-IFT74 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026684, RRID:AB_1846141) IFT74 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1846141 Antibody Registry Atlas Antibodies HPA026684 2024-07-24 08:30:17 0
Anti-GTF2I polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026638, RRID:AB_1857959) GTF2I rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1857959 Antibody Registry Atlas Antibodies HPA026638 2024-07-24 11:24:30 0
Anti-EPRS
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026490, RRID:AB_1855979) EPRS human Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1855979 Antibody Registry Atlas Antibodies HPA026490 2024-11-06 06:49:03 0
Anti-RPA2
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026309, RRID:AB_10601572) RPA2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10601572 Antibody Registry Atlas Antibodies HPA026309 2024-07-24 08:52:41 0
Anti-SH3GL2 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
(Atlas Antibodies Cat# HPA026685, RRID:AB_1856817) SH3GL2 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1856817 Antibody Registry Atlas Antibodies HPA026685 2024-11-06 08:22:11 1
Anti-TMEM242 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA025764, RRID:AB_1845742) TMEM242 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1845742 Antibody Registry Atlas Antibodies HPA025764 2024-11-06 03:33:52 0
Anti-BMP2K polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026436, RRID:AB_10600102) BMP2K human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600102 Antibody Registry Atlas Antibodies HPA026436 2024-07-25 02:53:39 0
Anti-STK24
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026502, RRID:AB_1854152) STK24 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1854152 Antibody Registry Atlas Antibodies HPA026502 2024-07-24 11:07:23 0
Anti-PEAK1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA026517, RRID:AB_1856802) PEAK1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1856802 Antibody Registry Atlas Antibodies HPA026517 2024-07-24 10:19:22 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.