Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

54,543 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Authority Vendor Catalog Number Record Last Update Mentions Count
Anti-RGN
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA029102, RRID:AB_10599846) RGN human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10599846 Antibody Registry Atlas Antibodies HPA029102 2024-07-25 12:45:05 0
Anti-SRCAP polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028929, RRID:AB_10601265) SRCAP human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601265 Antibody Registry Atlas Antibodies HPA028929 2024-07-24 05:09:35 0
Anti-KLF15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028866, RRID:AB_10600819) KLF15 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPG; Manufacturer approved use: IHC polyclonal rabbit AB_10600819 Antibody Registry Atlas Antibodies HPA028866 2024-07-24 07:40:44 0
Anti-ETV7
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA029033, RRID:AB_10601375) ETV7 human Originating manufacturer of this product. Applications: ICC-IF, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10601375 Antibody Registry Atlas Antibodies HPA029033 2024-07-25 12:03:15 0
Anti-HOXC8 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
(Atlas Antibodies Cat# HPA028911, RRID:AB_10602236) HOXC8 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602236 Antibody Registry Atlas Antibodies HPA028911 2024-07-25 02:29:35 3
Anti-HTR1B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028808, RRID:AB_2672782) HTR1B human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672782 Antibody Registry Atlas Antibodies HPA028808 2024-07-24 04:59:59 0
Anti-AP000322.53 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA029085, RRID:AB_10669867) AP000322.53 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10669867 Antibody Registry Atlas Antibodies HPA029085 2024-07-24 04:52:55 0
Anti-ELK4
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028863, RRID:AB_10602492) ELK4 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10602492 Antibody Registry Atlas Antibodies HPA028863 2024-07-25 02:48:23 0
Anti-AUNIP
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028730, RRID:AB_10670830) AUNIP human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10670830 Antibody Registry Atlas Antibodies HPA028730 2024-07-24 09:33:29 0
Anti-CYP4V2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA029122, RRID:AB_10601806) CYP4V2 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601806 Antibody Registry Atlas Antibodies HPA029122 2024-07-24 09:00:51 0
Anti-CALCR
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028962, RRID:AB_10602339) CALCR human Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10602339 Antibody Registry Atlas Antibodies HPA028962 2024-07-24 10:00:44 0
Anti-GOT1L1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028778, RRID:AB_10602138) GOT1L1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602138 Antibody Registry Atlas Antibodies HPA028778 2024-07-25 03:17:01 0
Anti-VAX1
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028946, RRID:AB_10602679) VAX1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10602679 Antibody Registry Atlas Antibodies HPA028946 2024-07-25 02:23:34 0
Anti-NRBP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA029052, RRID:AB_10602714) NRBP2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602714 Antibody Registry Atlas Antibodies HPA029052 2024-07-25 02:04:48 0
Anti-PPP2R5D
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA029046, RRID:AB_10600988) PPP2R5D rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10600988 Antibody Registry Atlas Antibodies HPA029046 2024-07-25 02:07:57 0
Anti-P2RX6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028776, RRID:AB_2672771) P2RX6 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672771 Antibody Registry Atlas Antibodies HPA028776 2024-07-25 02:50:06 0
Anti-MRPS10
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
(Atlas Antibodies Cat# HPA029134, RRID:AB_10600058) MRPS10 human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10600058 Antibody Registry Atlas Antibodies HPA029134 2024-07-24 06:49:42 1
Anti-ZNF514 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028974, RRID:AB_10603845) ZNF514 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603845 Antibody Registry Atlas Antibodies HPA028974 2024-07-24 05:21:24 0
Anti-HDAC9 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028926, RRID:AB_10602327) HDAC9 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602327 Antibody Registry Atlas Antibodies HPA028926 2024-07-24 09:49:03 0
Anti-EGR4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA028983, RRID:AB_10603665) EGR4 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603665 Antibody Registry Atlas Antibodies HPA028983 2024-07-24 07:10:27 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.