Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676251
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GTSF1
Proper citation: Atlas Antibodies Cat# HPA038877, RRID:AB_2676251 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671863
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRPT1
Proper citation: Atlas Antibodies Cat# HPA038706, RRID:AB_10671863 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10674844
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PPHLN1
Proper citation: Atlas Antibodies Cat# HPA038902, RRID:AB_10674844 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671868
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MBD6
Proper citation: Atlas Antibodies Cat# HPA038949, RRID:AB_10671868 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795032
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): NUDT6
Proper citation: Atlas Antibodies Cat# HPA039202, RRID:AB_10795032 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670918
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C14orf80
Proper citation: Atlas Antibodies Cat# HPA039050, RRID:AB_10670918 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676337
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CD7
Proper citation: Atlas Antibodies Cat# HPA039079, RRID:AB_2676337 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676323
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPG20
Proper citation: Atlas Antibodies Cat# HPA039054, RRID:AB_2676323 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676329
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNEL; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): DNAH10
Proper citation: Atlas Antibodies Cat# HPA039065, RRID:AB_2676329 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672831
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PACS1
Proper citation: Atlas Antibodies Cat# HPA038914, RRID:AB_10672831 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794426
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FRA10AC1
Proper citation: Atlas Antibodies Cat# HPA039204, RRID:AB_10794426 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676326
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAP6
Proper citation: Atlas Antibodies Cat# HPA039062, RRID:AB_2676326 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960353
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TCAF2
Proper citation: Atlas Antibodies Cat# HPA038758, RRID:AB_10960353 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796221
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PIGQ
Proper citation: Atlas Antibodies Cat# HPA039105, RRID:AB_10796221 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671036
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ACRBP
Proper citation: Atlas Antibodies Cat# HPA039082, RRID:AB_10671036 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10674979
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KLRB1
Proper citation: Atlas Antibodies Cat# HPA039113, RRID:AB_10674979 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673296
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C11orf96
Proper citation: Atlas Antibodies Cat# HPA038843, RRID:AB_10673296 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10675950
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PHF8
Proper citation: Atlas Antibodies Cat# HPA038779, RRID:AB_10675950 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676171
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ACRV1
Proper citation: Atlas Antibodies Cat# HPA038718, RRID:AB_2676171 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10697544
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DEF6
Proper citation: Atlas Antibodies Cat# HPA038975, RRID:AB_10697544 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.