Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-SYN3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA034566, RRID:AB_10603120 SYN3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603120 Atlas Antibodies HPA034566 2025-08-19 03:21:36 0
Anti-RHCG
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041874, RRID:AB_2677719 RHCG human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2677719 Atlas Antibodies HPA041874 2025-08-19 03:21:39 0
Anti-TOP2B
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050441, RRID:AB_2681127 TOP2B human Originating manufacturer of this product. Applications: WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2681127 Atlas Antibodies HPA050441 2025-08-19 03:21:39 0
Anti-VPS26A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA057498, RRID:AB_2683448 VPS26A human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683448 Atlas Antibodies HPA057498 2025-08-19 03:21:36 0
Anti-SLC6A11 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037981, RRID:AB_10671383 SLC6A11 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671383 Atlas Antibodies HPA037981 2025-08-19 03:21:38 0
Anti-NOM1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA019866, RRID:AB_2670300 NOM1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2670300 Atlas Antibodies HPA019866 2025-08-19 03:21:36 0
Anti-SNX25 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036928, RRID:AB_10669720 SNX25 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence APPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPE; Manufacturer approved use: IHC polyclonal rabbit AB_10669720 Atlas Antibodies HPA036928 2025-08-19 03:21:36 0
NFAT5-human
 
Resource Report
Resource Website
Rating or validation data
Bioss Cat# bs-9474R, RRID:AB_2615869 NFAT5 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot AD071123 for not specified; status is not pursued unknown rabbit AB_2615869 Bioss bs-9474R (also ENCAB485GVL) 2025-08-19 03:21:34 0
Rabbit anti-ZNF703 Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A304-074A, RRID:AB_2621323 ZNF703 human Applications: IP
Original Manufacturer
polyclonal rabbit AB_2621323 Bethyl A304-074A (also OWL-A19557, A304-074A-T) 2025-08-19 03:21:50 0
Anti-MDN1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029666, RRID:AB_10600888 MDN1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600888 Atlas Antibodies HPA029666 2025-08-19 03:22:17 0
Anti-DDX54 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028244, RRID:AB_10603885 DDX54 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603885 Atlas Antibodies HPA028244 2025-08-19 03:21:51 0
Anti-AK9 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030805, RRID:AB_2673618 AK9 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2673618 Atlas Antibodies HPA030805 2025-08-19 03:21:51 0
Anti-C16orf45
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041114, RRID:AB_10794542 C16orf45 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10794542 Atlas Antibodies HPA041114 2025-08-19 03:22:18 0
Anti-MGAT2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043721, RRID:AB_2678636 MGAT2 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678636 Atlas Antibodies HPA043721 2025-08-19 03:22:18 0
Anti-VWC2L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044815, RRID:AB_10962359 VWC2L human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10962359 Atlas Antibodies HPA044815 2025-08-19 03:22:18 0
Anti-SYNE4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA060253, RRID:AB_2684233 SYNE4 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684233 Atlas Antibodies HPA060253 2025-08-19 03:21:52 0
Anti-FIBIN
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040120, RRID:AB_10795243 FIBIN human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10795243 Atlas Antibodies HPA040120 2025-08-19 03:22:18 0
Anti-TAS2R39 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA053456, RRID:AB_2682157 TAS2R39 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682157 Atlas Antibodies HPA053456 2025-08-19 03:22:18 0
Anti-CSH1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043715, RRID:AB_2678632 CSH1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678632 Atlas Antibodies HPA043715 2025-08-19 03:21:51 0
Anti-SKIDA1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039208, RRID:AB_10795034 SKIDA1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795034 Atlas Antibodies HPA039208 2025-08-19 03:21:51 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.