Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079218
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): KTN1
Proper citation: Atlas Antibodies Cat# HPA003178, RRID:AB_1079218 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963048
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): AC131097.4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043982, RRID:AB_10963048 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602691
Comments: Vendor recommendations: Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF774 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030840, RRID:AB_10602691 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845312
Comments: Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): BCL10 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA017925, RRID:AB_1845312 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601440
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): MRPL18 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028775, RRID:AB_10601440 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853346
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRRC8B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA017950, RRID:AB_1853346 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2120669
Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC10220 for not specified; status is not pursued; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615130, AB_2120669.
Host Organism: rabbit
Clonality: unknown
Target(s): HNRNPDL
Proper citation: Aviva Systems Biology Cat# ARP40585_T100, RRID:AB_2120669 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961139
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): UTP23 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044418, RRID:AB_10961139 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10630100
Comments: Discontinued; Applications: IHC (1:1,000-1:5,000), IP (2-5 µg/mg lysate)
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARNT
Proper citation: Thermo Fisher Scientific Cat# A302-764A, RRID:AB_10630100 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684796
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KATNBL1
Proper citation: Atlas Antibodies Cat# HPA062573, RRID:AB_2684796 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683016
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FLRT3
Proper citation: Atlas Antibodies Cat# HPA056033, RRID:AB_2683016 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10966289
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): COMMD2
Proper citation: Atlas Antibodies Cat# HPA044190, RRID:AB_10966289 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854503
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SLC12A1
Proper citation: Atlas Antibodies Cat# HPA014967, RRID:AB_1854503 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680938
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): STAU1
Proper citation: Atlas Antibodies Cat# HPA049892, RRID:AB_2680938 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600755
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): LRRC75A
Proper citation: Atlas Antibodies Cat# HPA028528, RRID:AB_10600755 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685930
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FOXB2
Proper citation: Atlas Antibodies Cat# HPA067947, RRID:AB_2685930 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682278
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KCNN4
Proper citation: Atlas Antibodies Cat# HPA053841, RRID:AB_2682278 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732563
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): WDR7
Proper citation: Atlas Antibodies Cat# HPA051057, RRID:AB_2732563 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680708
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMED3
Proper citation: Atlas Antibodies Cat# HPA049314, RRID:AB_2680708 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673241
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KAEETHSSLSQELQARLQTVTREKEELLQLSIERGKVLQNKQAEICQLEEKLEIANEDRKHALERFEQEAVAVDSNLRVRELQRKVDGIQKAYDELRLQ; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC89
Proper citation: Atlas Antibodies Cat# HPA039351, RRID:AB_10673241 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.