Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_331772
Comments: Applications: W, IP, IHC-P. Consolidation: AB_2315155.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: monoclonal
Target(s): Phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204)
Proper citation: Cell Signaling Technology Cat# 4376, RRID:AB_331772 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683047
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SOWAHC
Proper citation: Atlas Antibodies Cat# HPA056131, RRID:AB_2683047 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855594
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GDA
Proper citation: Atlas Antibodies Cat# HPA024099, RRID:AB_1855594 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602100
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): VPS37A
Proper citation: Atlas Antibodies Cat# HPA024781, RRID:AB_10602100 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2666207
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PTGR2
Proper citation: Atlas Antibodies Cat# HPA001125, RRID:AB_2666207 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685333
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SCML2
Proper citation: Atlas Antibodies Cat# HPA064713, RRID:AB_2685333 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669856
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ECM2
Proper citation: Atlas Antibodies Cat# HPA035347, RRID:AB_10669856 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078705
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DRG2
Proper citation: Atlas Antibodies Cat# HPA007716, RRID:AB_1078705 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858577
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UBQLN3
Proper citation: Atlas Antibodies Cat# HPA020547, RRID:AB_1858577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601097
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): CD300LD
Proper citation: Atlas Antibodies Cat# HPA027756, RRID:AB_10601097 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2288587
Comments: seller recommendations: Immunohistochemistry; IH
Clonality: polyclonal
Target(s): Vasoactive Intestinal Peptide
Proper citation: Millipore Cat# AB1581, RRID:AB_2288587 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602398
Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): SH3BGRL3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030848, RRID:AB_10602398 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857681
Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Western Blot; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): SVIL antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA020138, RRID:AB_1857681 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079867
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunofluorescence; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAPK13 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA007667, RRID:AB_1079867 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603121
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): NFAM1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031812, RRID:AB_10603121 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683775
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): DPEP3
Proper citation: Atlas Antibodies Cat# HPA058607, RRID:AB_2683775 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682704
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLIC6
Proper citation: Atlas Antibodies Cat# HPA055123, RRID:AB_2682704 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732326
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): HEYL
Proper citation: Atlas Antibodies Cat# HPA076960, RRID:AB_2732326 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960062
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): GNG13 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA046272, RRID:AB_10960062 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2129681
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): ITLN2
Proper citation: Sigma-Aldrich Cat# HPA006683, RRID:AB_2129681 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.