Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Validation:information available (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Target Antigen

Sort Ascending

Sort Descending

 Target Organism

Sort Ascending

Sort Descending

 Clone ID
Defining Citation

Sort Ascending

Sort Descending

 Comments
Clonality

Sort Ascending

Sort Descending

 Host Organism

Sort Ascending

Sort Descending

 Antibody ID
Vendor

Sort Ascending

Sort Descending

 Catalog Number
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
Anti-SPHK1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA028761, RRID:AB_10600814 SPHK1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTAS; Manufacturer approved use: IHC polyclonal rabbit AB_10600814 Atlas Antibodies HPA028761 2025-08-19 03:51:03 0
Anti-RPL32
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA047501, RRID:AB_2680070 RPL32 human unknown rabbit AB_2680070 Sigma-Aldrich HPA047501 2025-08-19 03:51:05 0
Anti-CPEB1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA040396, RRID:AB_2676960 CPEB1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676960 Atlas Antibodies HPA040396 2025-08-19 03:50:44 0
Anti-BCORL1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA068568, RRID:AB_2686007 BCORL1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686007 Atlas Antibodies HPA068568 2025-08-19 03:51:04 0
Anti-FAM135A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA031743, RRID:AB_10600767 FAM135A human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600767 Atlas Antibodies HPA031743 2025-08-19 03:51:03 0
Anti-TBPL2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA056241, RRID:AB_2683076 TBPL2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683076 Atlas Antibodies HPA056241 2025-08-19 03:51:04 0
chd-3-celegans
 
Resource Report
Resource Website
Rating or validation data 		SDIX Cat# 4889.00.02, RRID:AB_2616391 chd-3 caenorhabditis elegans ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization unknown rabbit AB_2616391 SDIX 4889.00.02 (also ENCAB043BYA) 2025-08-19 03:51:54 0
Anti-RNF208 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA021256, RRID:AB_1844331 RNF208 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1844331 Atlas Antibodies HPA021256 2025-08-19 03:49:49 0
Anti-SEC13
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA035292, RRID:AB_10959451 SEC13 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10959451 Atlas Antibodies HPA035292 2025-08-19 03:49:50 0
Anti-BLOC1S1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA021381, RRID:AB_2228026 BLOC1S1 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_2228026 Sigma-Aldrich HPA021381 2025-08-19 03:49:50 0
Anti-TPRX1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Sigma-Aldrich Cat# HPA044922, RRID:AB_10962509 TPRX1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable polyclonal AB_10962509 Sigma-Aldrich HPA044922 2025-08-19 03:49:53 1
Anti-ARRDC1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA044345, RRID:AB_10965181 ARRDC1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable polyclonal AB_10965181 Sigma-Aldrich HPA044345 2025-08-19 03:49:24 0
Anti-DRGX antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA043978, RRID:AB_10961154 DRGX antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10961154 Sigma-Aldrich HPA043978 2025-08-19 03:49:24 0
Anti-GSPT2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA044769, RRID:AB_10963577 GSPT2 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable polyclonal AB_10963577 Sigma-Aldrich HPA044769 2025-08-19 03:49:23 0
Anti-COLEC10 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA024511, RRID:AB_1847084 Human COLEC10 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1847084 Sigma-Aldrich HPA024511 2025-08-19 03:49:25 0
Anti-ANAPC11 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA021989, RRID:AB_1844915 Human ANAPC11 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1844915 Sigma-Aldrich HPA021989 2025-08-19 03:49:51 0
Rabbit anti-Sp3 Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data 		Bethyl Cat# A302-485A, RRID:AB_1966069 Sp3 human Discontinued: 2016; Original manufacturer of this product; Validation by IP/Western Blot was performed using ReliaBLOTﾨ Western Blot Gel 4-8%, 10 x 10 cm (Cat. No. WB101-40812G) and ReliaBLOTﾨ Reagents (Cat. No. WB120). Related products include ReliaBLOTﾨ IP/WB kits, buffers and reagents.IHC validation was performed using Immunohistochemistry Accessory Kit (Cat. # IHC-101). Applications: WB,IP,IHC Paraffin,IF Dilution: WB - 1:2,000 to 1:10,000 / IP - 2 to 5 ﾵg/mg lysate / IHC - 1:1,000 to 1:5,000. Epitope retrieval with citrate buffer pH6.0 is recommended for FFPE tissue sections. / IF - 1:500 to 1:2,500. unknown rabbit AB_1966069 Bethyl A302-485A 2025-08-19 03:49:31 0
Anti-FAT1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Sigma-Aldrich Cat# HPA023882, RRID:AB_1848429 FAT1 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other polyclonal rabbit AB_1848429 Sigma-Aldrich HPA023882 2025-08-19 03:49:41 1
Proinsulin Monoclonal Antibody (3A1)
 
Resource Report
Resource Website
1+ mentions
Rating or validation data 		Thermo Fisher Scientific Cat# MA1-22710, RRID:AB_558517 Proinsulin human Clone 3A1 Discontinued: 2023; Applications: IHC (F) (Assay-dependent), ELISA (Assay-dependent) monoclonal mouse AB_558517 Thermo Fisher Scientific MA1-22710 2025-08-19 03:39:58 2
Anti-IKBIP
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA061541, RRID:AB_2684555 IKBIP human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2684555 Atlas Antibodies HPA061541 2025-08-19 03:40:07 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

dkNET community events and announcements in August, 2026

HIRN Funding Opportunity: SPARKS Award

Join the Whole Person Physiome 1st Data Jamboree on August 24-25

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch