Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_2521166
Comments: WB, IHC-P
Host Organism: rabbit
Clonality: unknown
Target(s): CPNE1
Proper citation: Creative Diagnostics Cat# DPABH-05291, RRID:AB_2521166 Copy
http://antibodyregistry.org/AB_2656404
Comments: Applications: MACS Flow Cytometry
Antigen Distribution: B cells, T cells, endothelial cells
Host Organism: human
Clonality: monoclonal
Target(s): CD222
Proper citation: Miltenyi Biotec Cat# 130-100-871, RRID:AB_2656404 Copy
http://antibodyregistry.org/AB_2611182
Comments: Immunohistochemistry,IF Microscopy,Western Blot, Anti-IP3 Antibody is suitable for use in WB, IP, and IHC
Host Organism: mouse
Clonality: monoclonal
Target(s): IP3 Receptor Antibody
Proper citation: Rockland Cat# 200-301-F77, RRID:AB_2611182 Copy
http://antibodyregistry.org/AB_2618588
Comments: Application(s): Immunoprecipitation,Microarray; Date Deposited: 07/08/2015
Host Organism: mouse
Clonality: monoclonal
Target(s): EHMT2; Euchromatic histone-lysine N-methyltransferase 2
Proper citation: DSHB Cat# PCRP-EHMT2-3D9, RRID:AB_2618588 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10610279
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PHACTR2
Proper citation: Atlas Antibodies Cat# HPA031725, RRID:AB_10610279 Copy
Discontinued
http://antibodyregistry.org/AB_2571359
Comments: Discontinued; Dilution:WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.; Purification: Protein G Purified; Specificity: Detects ~75kDa.; This clone was listed and recorded at the vendor as S91-36. However this has now been confirmed to be K91/36 by the originator of the clone.
Host Organism: mouse
Clonality: monoclonal
Target(s): Synthetic peptide amino acids 477-498 of human Wave1/Wasp family1
Proper citation: StressMarq Biosciences Cat# SMC-381S, RRID:AB_2571359 Copy
Discontinued
http://antibodyregistry.org/AB_2572830
Comments: Discontinued: 2017; Original Manufacturer eBioscience, now part of Thermo Fisher; Applications: IF (Assay-Dependent), IHC (P) (2.5 ug/mL), ICC (Assay-Dependent); Reactive Species: Human
Host Organism: mouse
Clonality: monoclonal
Target(s): Progesterone Receptor
Proper citation: Thermo Fisher Scientific Cat# 13-9764-80, RRID:AB_2572830 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616533
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality: unknown
Target(s): Psc
Proper citation: Vincenzo Pirrotta Cat# non-commercial Psc modENCODE antibody 1, RRID:AB_2616533 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682709
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM170B
Proper citation: Atlas Antibodies Cat# HPA055134, RRID:AB_2682709 Copy
Discontinued
http://antibodyregistry.org/AB_2543203
Comments: Discontinued; Applications: Western Blot (1:100-500); Reactive Species: Human
Host Organism: rabbit
Clonality: polyclonal
Target(s): OR13C4
Proper citation: Thermo Fisher Scientific Cat# PA5-25703, RRID:AB_2543203 Copy
http://antibodyregistry.org/AB_2518972
Comments: WB
Host Organism: rabbit
Clonality: unknown
Target(s): SOX9
Proper citation: Creative Diagnostics Cat# DPABH-25892, RRID:AB_2518972 Copy
http://antibodyregistry.org/AB_2524780
Comments: WB
Host Organism: rabbit
Clonality: unknown
Target(s): C16ORF78
Proper citation: Creative Diagnostics Cat# DPABH-13040, RRID:AB_2524780 Copy
http://antibodyregistry.org/AB_2514997
Comments: IP
Host Organism: rabbit
Clonality: unknown
Target(s): RUVBL2
Proper citation: Creative Diagnostics Cat# DPABH-19154, RRID:AB_2514997 Copy
http://antibodyregistry.org/AB_2516405
Comments: WB
Host Organism: rabbit
Clonality: unknown
Target(s): PIAS3
Proper citation: Creative Diagnostics Cat# DPABH-21353, RRID:AB_2516405 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2072056
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CCDC146
Proper citation: Atlas Antibodies Cat# HPA020105, RRID:AB_2072056 Copy
Discontinued
http://antibodyregistry.org/AB_10954774
Comments: Discontinued: 2015; Discontinued on 27 July 2015; manufacturer recommendations: Western Blot,E; Western Blot
Host Organism: mouse
Clonality: monoclonal
Target(s): Mouse Human TNK1 MAAG4712
Proper citation: Creative Biomart Cat# CAB-6905MH, RRID:AB_10954774 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667540
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIF2C
Proper citation: Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 Copy
http://antibodyregistry.org/AB_2520606
Comments: WB, ICC/IF
Host Organism: rabbit
Clonality: unknown
Target(s): NKIRAS2
Proper citation: Creative Diagnostics Cat# DPABH-04046, RRID:AB_2520606 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078701
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNFRSF21
Proper citation: Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 Copy
http://antibodyregistry.org/AB_1157092
Comments: functionality unknown, check validation data for this product with vendor
Host Organism: mouse
Clonality: monoclonal
Target(s): Clostridium tetani toxoid
Proper citation: Cell Sciences Cat# CSI17228, RRID:AB_1157092 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.